KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_1569Help
Entry
SaurJH9_1569      CDS       T00522                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase (decarboxylating)
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj00030  Pentose phosphate pathway
saj00480  Glutathione metabolism
saj01100  Metabolic pathways
saj01110  Biosynthesis of secondary metabolites
saj01120  Microbial metabolism in diverse environments
saj01130  Biosynthesis of antibiotics
saj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:saj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SaurJH9_1569
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SaurJH9_1569
Enzymes [BR:saj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     SaurJH9_1569
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     SaurJH9_1569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 2-Hacid_dh_C 3HCDH_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABQ49362
Position
complement(1675342..1676748)
Genome map
AA seq 468 aa AA seqDB search
MTQQIGVIGLAVMGKNLAWNIESRGYSVSVFNRSSEKTDLMVEESKGKNIHPTYSLEEFV
NSLEKPRKILLMVQAGKATDATIDSLLPLLDDGDILIDGGNTNYQDTIRRNKALAQSAIN
FIGMGVSGGEIGALTGPSLMPGGQEEAYNKVADILDAIAAKAKDGASCVTYIGPNGAGHY
VKMVHNGIEYADMQLIAESYAMMKELLGMSHEDIAQTFKDWNAGELESYLIEITGDIFMK
LDENKEALVEKILDTAGQKGTGKWTSINALELGIPLTIITESVFARFISSIKEERVNASK
ELNGPKASFDGDKKDFLEKIRKALYMSKICSYAQGFAQMRKASEDNEWNLKLGDLAMIWR
EGCIIRAQFLQKIKDAYDNNPGLQNLLLDPYFKNIVTEYQDALRDVVATGVQNGVPTPGF
SSSINYYDSYRAADLPANLIQAQRDYFGAHTYERKDKEGVFHTQWIEE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaaattggagttattggtttagccgttatgggtaaaaacctagcttggaat
attgaatcacgcggatatagtgtatctgtatttaaccgctcaagtgaaaaaactgattta
atggttgaagaatcaaaagggaaaaatattcatccaacgtattcattggaagaatttgtt
aattctttagaaaaaccacgtaaaattttattaatggttcaagcaggtaaagctacggat
gcaacaattgatagtttgttacctttattagatgatggagatattttaattgatggtggt
aatacaaactatcaagatactatcagacgtaataaagcattagcacaaagtgcaatcaac
tttattggtatgggcgtttctggtggtgaaattggagcgttaactggtccgtcattaatg
ccgggtggacaagaagaagcttataacaaagttgcagatattcttgatgcaattgctgct
aaggcaaaagacggtgcttcatgtgttacttatattggaccaaatggtgctggacactat
gtgaaaatggtacataatggtattgaatatgctgacatgcaattaattgcagaaagttat
gctatgatgaaagaattattaggtatgtctcatgaagacattgctcaaacgttcaaagac
tggaatgctggtgaattagaaagttatttaattgaaatcactggtgatattttcatgaaa
ttagatgaaaataaagaagcattagttgaaaaaattcttgatactgcaggtcaaaaaggt
acaggaaaatggacttcaattaatgcattagaattaggtattccattaacaatcattact
gaatctgtatttgcacgttttatctcttcaatcaaagaagagcgcgtaaatgcttctaaa
gaattaaatggtccaaaagcatcatttgatggtgataagaaagactttttagaaaaaatt
cgtaaagcattatatatgagtaaaatttgttcttatgcacaaggtttcgcgcaaatgcgt
aaagcaagtgaagataatgaatggaatttaaaacttggtgatttagctatgatttggaga
gaaggttgcattatacgtgcacaattcttacaaaagatcaaagatgcttacgataataat
ccaggattacaaaacttattgctagatccttactttaaaaacatcgttactgaatatcaa
gatgcgttacgtgatgttgtcgcaactggtgttcaaaatggtgtaccaacacctggtttc
tcatcaagtattaattactatgatagttaccgtgcagctgatttacctgcaaacttaatt
caagcacaacgtgactacttcggtgctcacacgtacgaaagaaaagataaagaaggcgta
ttccatacacaatggattgaagaataa

DBGET integrated database retrieval system