KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA): SaurJH9_2196Help
Entry
SaurJH9_2196      CDS       T00522                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VRSA)
Pathway
saj00220  Arginine biosynthesis
saj00330  Arginine and proline metabolism
saj01100  Metabolic pathways
saj01110  Biosynthesis of secondary metabolites
saj01130  Biosynthesis of antibiotics
saj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saj00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SaurJH9_2196
   00330 Arginine and proline metabolism
    SaurJH9_2196
Enzymes [BR:saj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SaurJH9_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABQ49977
Position
complement(2328917..2329825)
Genome map
AA seq 302 aa AA seqDB search
MTKTKAIDIIGAPSTFGQRKLGVDLGPTAIRYAGLISRLKQLDLDVYDKGDIKVPAVNIE
KFHSEQKGLRNYDEIIDVNQKLNKEVSASIENNRFPLVLGGDHSIAVGSVSAISKHYNNL
GVIWYDAHGDLNIPEESPSGNIHGMPLRILTGEGPKELLELNSNVIKPENIVLIGMRDLD
KGERQFIKDHNIKTFTMSDIDKLGIKEVIENTIEYLKSRNVDGVHLSLDVDALDPLETPG
TGTRVLGGLSYRESHFALELLHQSHLISSMDLVEVNPLIDSNNHTAEQAVSLVGTFFGET
LL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagacaaaagcaattgatattataggtgcaccatcaacatttggacaaagaaaa
ttaggtgttgatttaggaccaacagcaattagatatgctggattaatttcaagattaaag
caattagaccttgatgtatatgacaagggggatattaaggtacctgctgtgaacattgaa
aaatttcatagtgaacaaaaaggattaagaaattatgatgaaattatagatgttaatcaa
aaattaaataaagaggtttcagcatcaattgaaaataacagatttcctctagttcttggt
ggtgatcattctattgcggtaggttcagtatcagcaataagtaaacattataataattta
ggtgttatttggtatgatgcacatggtgatttaaatatacctgaagagtcaccaagtgga
aatattcatggtatgcctctaaggattttgacaggcgaaggtcccaaagaacttttagaa
ttaaatagtaatgtaatcaagccagaaaacatcgtactaattggtatgagagatttagat
aaaggtgaaagacaatttatcaaagatcataatattaaaacatttactatgtcagatatt
gataaattagggataaaggaagtaattgaaaatacaatagaatatttgaagtcacgcaat
gttgatggcgttcatttatctttagatgttgatgctttagatccgcttgaaacgccaggc
actggtactagagttttgggtggtcttagttatagagaaagccattttgcattggaatta
ctgcatcaatcacatttaatttcctcaatggatttagttgaagtaaatccattgattgac
agtaataatcatactgctgaacaagcggtttcattagttggaacattttttggtgaaact
ttattataa

DBGET integrated database retrieval system