KEGG   Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA): SaurJH9_2568Help
Entry
SaurJH9_2568      CDS       T00522                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-coenzyme A reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
saj  Staphylococcus aureus subsp. aureus JH9 (MRSA/VISA)
Pathway
saj00900  Terpenoid backbone biosynthesis
saj01110  Biosynthesis of secondary metabolites
saj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saj00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SaurJH9_2568
Enzymes [BR:saj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SaurJH9_2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red UPF0180 Co_AT_N
Motif
Other DBs
NCBI-ProteinID: ABQ50345
Position
complement(2716003..2717280)
Genome map
AA seq 425 aa AA seqDB search
MQSLDKNFRHLSRQQKLQQLVDKQWLSEDQFDILLNHPLIDEEVANSLIENVIAQGALPV
GLLPNIIVDDKAYVVPMMVEEPSVVAAASYGAKLVNQTGGFKTVSSERIMIGQIVFDGVD
DTEKLSADIKALEKQIHKIADEAYPSIKARGGGYQRIAIDTFPEQQLLSLKVFVDTKDAM
GANMLNTILEAITAFLKNESPQSDILMSILSNHATASVVKVQGEIDVKDLARGERTGEEV
AKRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGAEASAHAYASRDGQYRGI
ATWRYDQKRQRLIGTIEVPMTLAIVGGGTKVLPIAKASLELLNVDSAQELGHVVAAVGLA
QNFAACRALVSEGIQQGHMSLQYKSLAIVVGAKGDEIAQVAEALKQEPRANTQVAERILQ
EIRQQ
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtttagataagaatttccgacatttatctcgtcaacaaaagttacaacaattg
gtagataagcaatggttatcagaagatcaattcgacattttattgaatcatccattaatt
gatgaggaagtagcaaatagtttaattgaaaatgtcatcgcgcaaggtgcattacccgtt
ggattattaccgaatatcattgtggacgataaggcatatgttgtacctatgatggtggaa
gagccttcagttgtcgctgcagctagttatggtgcaaagctagtgaatcagactggcgga
tttaaaacggtatcttctgaacgtattatgataggtcaaatcgtctttgatggcgttgac
gatactgaaaaattatcagcagacattaaagctttagaaaagcaaattcataaaattgcg
gatgaggcatatccttctattaaagcgcgtggtggtggttaccaacgtatagctattgat
acatttcctgagcaacagttactatctttaaaagtatttgttgatacgaaagatgctatg
ggcgctaatatgcttaatacgattttagaggccataactgcatttttaaaaaatgaatct
ccacaaagcgacattttaatgagtattttatccaatcatgcaacagcgtccgttgttaaa
gttcaaggcgaaattgacgttaaagatttagcaaggggcgagagaactggagaagaggtt
gccaaacgaatggaacgtgcttctgtattggcacaagttgatattcatcgtgctgcaaca
cataataaaggtgttatgaatggcatacatgccgttgttttagcaacaggaaatgatacg
cgtggtgcagaagcaagtgcgcatgcatacgcgagtcgtgacggacagtatcgtggtatt
gcaacatggagatacgatcaaaaacgtcaacgtttaattggtacaatagaagtgcctatg
acattggcaatcgttggcggtggtacaaaagtattaccaattgctaaagcttctttagaa
ttgctaaatgtagattcagcacaagaattaggtcatgtagttgctgccgttggtttagca
cagaactttgcagcatgtcgcgcgctcgtttccgaaggtatccagcaaggccatatgagc
ttgcaatataaatctttagctattgttgtaggtgcaaaaggtgatgaaattgcgcaagta
gctgaagcattgaagcaagaaccccgtgcgaatacacaagtagctgaacgcattttacaa
gaaattagacaacaatag

DBGET integrated database retrieval system