KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0568Help
Entry
SAK_0568          CDS       T00278                                 

Definition
(GenBank) acetyl-CoA acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00071  Fatty acid degradation
sak00072  Synthesis and degradation of ketone bodies
sak00280  Valine, leucine and isoleucine degradation
sak00310  Lysine degradation
sak00362  Benzoate degradation
sak00380  Tryptophan metabolism
sak00620  Pyruvate metabolism
sak00630  Glyoxylate and dicarboxylate metabolism
sak00640  Propanoate metabolism
sak00650  Butanoate metabolism
sak00900  Terpenoid backbone biosynthesis
sak01100  Metabolic pathways
sak01110  Biosynthesis of secondary metabolites
sak01120  Microbial metabolism in diverse environments
sak01130  Biosynthesis of antibiotics
sak01200  Carbon metabolism
sak01212  Fatty acid metabolism
sak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAK_0568
   00630 Glyoxylate and dicarboxylate metabolism
    SAK_0568
   00640 Propanoate metabolism
    SAK_0568
   00650 Butanoate metabolism
    SAK_0568
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAK_0568
   00072 Synthesis and degradation of ketone bodies
    SAK_0568
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAK_0568
   00310 Lysine degradation
    SAK_0568
   00380 Tryptophan metabolism
    SAK_0568
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAK_0568
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAK_0568
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAK_0568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sak04147]
    SAK_0568
Enzymes [BR:sak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAK_0568
Exosome [BR:sak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAK_0568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: ABA45986
Position
510964..512079
Genome map
AA seq 371 aa AA seqDB search
MKNRDVYIGFGLRTPIGIKGKQFKHYRPELLGAHLLNQIKKIESESNIDSIICGNTVGTG
GNIGRLMTLFSDYESYIPVQTIDMQCASSSSALFFGYLKISTGINEKVLVGGIESSSLQP
MRRYAKEDNRNGEYTVAQFSPDSYAETVMLEGAQRVCQKYGFRREMLDKLAFLSHKRALT
AKQGGYLEEVILPMEGMRDQGVRKLKETFFQKLPRLMENSPLLTIGNVCLMHDAAAFLTL
QSQKTEFRIVHIVEVAGDPKLSPELVHTATEKLLTETHTKISDYDAIEWNEPFAAIDALF
NHYYPEEREKFNIFGGTLAYGHPYACSGIINILHLMQALKYKNKPMGLTAIAGAGGVGMA
ISIEYLGVKNA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagagatgtttatattggttttgggctacgaacacctatcggtataaaaggg
aagcaatttaaacattaccgtccagaacttttaggagcacaccttttaaatcaaataaaa
aaaatagaatcagaatctaacattgatagtattatttgtgggaacacagttggtactggg
ggcaatattggtcgtttgatgactcttttttctgattatgaatcctatattccagtacaa
acgattgatatgcagtgtgcttcatcaagttctgccttgttttttggttatctaaaaatc
agtaccggtattaatgaaaaagttcttgttggggggattgaaagtagttctcttcaacct
atgagacgttatgctaaagaagataatcgtaacggagaatatacagttgctcagttttct
cctgactcttatgctgaaactgtaatgttagaaggggcccagagagtctgtcaaaaatat
ggttttagaagagaaatgttagataaattggcattcttgagccataaacgcgccttaaca
gctaaacaaggtggctatttagaagaggtaatcttaccaatggaagggatgcgagatcaa
ggcgttagaaaactaaaagaaacattttttcaaaaattaccaagattgatggaaaattca
cctttgctcactattggaaatgtttgtttaatgcacgatgctgctgcatttctaacgctt
cagagtcagaaaacagaattccggattgttcacattgtagaagtagcaggagatcccaag
cttagtccagaattggttcacacggctacggaaaaactattaacagaaactcatactaaa
atatcggattatgatgcaattgaatggaatgaaccatttgcagcgattgatgctctattt
aatcattattatcctgaagagagagaaaaattcaatatttttggagggacattagcttac
ggacacccttatgcctgctcaggaattattaatatccttcatcttatgcaggcattaaaa
tataaaaataaacctatgggtctaactgccattgcaggggcaggaggagtcggaatggcc
atatcaatagagtacttaggagttaagaatgcttga

DBGET integrated database retrieval system