KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_0888Help
Entry
SAK_0888          CDS       T00278                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00010  Glycolysis / Gluconeogenesis
sak00051  Fructose and mannose metabolism
sak00562  Inositol phosphate metabolism
sak01100  Metabolic pathways
sak01110  Biosynthesis of secondary metabolites
sak01120  Microbial metabolism in diverse environments
sak01130  Biosynthesis of antibiotics
sak01200  Carbon metabolism
sak01230  Biosynthesis of amino acids
Module
sak_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sak_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAK_0888 (tpiA)
   00051 Fructose and mannose metabolism
    SAK_0888 (tpiA)
   00562 Inositol phosphate metabolism
    SAK_0888 (tpiA)
Enzymes [BR:sak01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SAK_0888 (tpiA)
Exosome [BR:sak04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SAK_0888 (tpiA)
  Exosomal proteins of bladder cancer cells
   SAK_0888 (tpiA)
  Exosomal proteins of melanoma cells
   SAK_0888 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABA46213
UniProt: Q3K1U3
Position
835633..836391
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFIEAVASKLPSSELVEAGIAAPALTLSTVLEAAKGSEL
KIAAQNSYFENSGAFTGENSPKVLAEMGTDYVVIGHSERRDYFHETDQDINKKAKAIFAN
GLTPIICCGESLETYEAGKAVEFVGAQVSAALAGLSEEQVSSLVIAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQAVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLE
AESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaataaaaatccagaagaagca
aaagcattcatcgaagcagtagcttctaaattaccatcatcagaacttgttgaagcaggg
attgctgctccagcgcttactttatcaacagttcttgaagcagctaaaggttcagaattg
aaaatcgctgctcaaaatagctattttgagaattcaggtgcattcactggtgaaaacagc
cctaaagtattggctgaaatgggtacagactacgttgttatcggtcactcagaacgtcgt
gattatttccatgaaactgaccaagatatcaacaaaaaagcaaaagctatctttgctaat
ggtttgactccaatcatttgttgcggtgagtctcttgaaacttacgaagctggtaaagcg
gttgaattcgtaggtgctcaagtttcagcagctcttgcaggtttgtcagaagagcaagta
tcatcacttgttatcgcttacgaaccaatctgggctattggtactggtaaatcagcaact
caagacgacgcacaaaacatgtgtaaagcagttcgtgacgttgttgcagcagacttcggt
caagcagttgctgacaaagttcgcgttcaatacggtggttcagttaaacctgaaaacgtt
gcagaatatatggcttgcccagacgttgacggtgcccttgtaggtggagcttcacttgaa
gcagaaagcttccttgccttattagattttgttaaataa

DBGET integrated database retrieval system