KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1695Help
Entry
SAK_1695          CDS       T00278                                 

Definition
(GenBank) immunogenic secreted protein, putative
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHAP Glucosaminidase Macoilin
Motif
Other DBs
NCBI-ProteinID: ABA45924
Position
complement(1683038..1684576)
Genome map
AA seq 512 aa AA seqDB search
MSKQKVMATLLLSTLVLSLSSPLVTLAETINPETSLTMATASTESSSEAEKQEKTQPTDS
ETASPSAEGSISTEKTEIGTTETSSSNESSSSSSHQSSSNEDAKTSDSASTASTPSTNTT
NSSQADSKPGQSTKTELKPEPTLPLVEPKITPAPSQIESVQTNQNASVPALSFDDNLLST
PISPVTATPFYVEHWSGQDAYSHYLLSHRYGIKAEQLDGYLKSLGIQYDSNRINGAKLLQ
WEKDSGLDVRAIVAIAVLESSLGTQGVAKMPGANMFGYGAFDHDSSHASAYNDEEAIMLL
TKNTIIKNNNSSFEIQDLKAQKLSSGQLNTVTEGGVYYTDNSGTGKRRAQIMEDLDRWID
QHGGTPEIPAALKALSTASLADLPSGFSLSTAVNTASYIASTYPWGECTWYVFNRAKELG
YTFDPFMGNGGDWQHKAGFETTHSPKVGYAVSFSPGQAGADGTYGHVAIVEEVKKDGSVL
ISESNAMGRGIVSYRTFSSAQAAQLTYVIGHK
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaacaaaaagtaatggcaactttgttgttatccactttagtcttatcgctatca
tcacctttagtgaccttagcagaaactattaatccagaaacaagcctgacaatggcaaca
gcatcaacagaaagttcttctgaagcagagaaacaggaaaaaacacaacctacagattca
gaaactgcttcaccttcagccgaaggaagtatctcaacagaaaaaacagagattggtacg
acagagacatcatcaagcaatgaatcatcatcaagttcatcacatcaatcttcttccaac
gaagatgctaaaacatctgattctgcttcaacagcatctactcctagcactaatactaca
aacagtagtcaagcagacagtaagccaggtcaatcaacaaagactgaattaaaacctgag
cctaccttaccattagtagagcctaaaataactcccgctccgtctcagatagaaagtgtt
cagacaaatcagaatgcttctgttcctgctttatcctttgatgataacttattatcaaca
ccgatttcaccagtgacagcaacgccattctacgtagaacactggtctggtcaggatgcc
tactctcactatttattgtcacatcgttacggtatcaaagctgaacaattagatgggtac
ttaaaatctttagggattcaatatgattctaatcgtatcaatggtgctaagttattacaa
tgggaaaaagatagtggtttagatgtccgtgctattgtagctattgctgtccttgaaagt
tcattgggaactcaaggagtggctaagatgccaggtgctaatatgtttggttatggtgcc
tttgatcatgactctagccatgctagtgcttataatgatgaagaagcaattatgttgttg
acaaaaaatacaattattaaaaacaacaactctagctttgaaatccaagatttgaaagca
cagaaattatcttctggacaacttaatacagttactgagggtggtgtttattatacagat
aactctggaactggtaaacgtcgtgcccagattatggaagatttagaccgctggattgat
caacatggagggacaccagaaattcctgctgccttgaaagctttatcgacagcaagttta
gcagatttaccaagtggttttagcttatcaacagcagttaacacagctagctatattgca
tcaacttatccatggggtgaatgtacatggtatgtctttaaccgcgctaaagagttaggt
tatacatttgatccatttatgggtaatggtggagattggcaacataaggctggttttgaa
acaacacattcaccaaaagtaggctatgctgtatcattttcaccaggacaagctggtgct
gatggcacttacggtcacgtagctattgttgaagaagttaaaaaagatggttcagttctt
atttcagaatctaatgcaatgggacgtggtattgtctcttaccgtacttttagttcagca
caagctgcacaattaacttatgttattggccataaataa

DBGET integrated database retrieval system