KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1710Help
Entry
SAK_1710          CDS       T00278                                 

Definition
(GenBank) hypothetical protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA45173
Position
complement(1699881..1700051)
Genome map
AA seq 56 aa AA seqDB search
MNKILAIGTEIAPVIGAVASIGVKALYNNSKSFRNVISSTGNVINNIDKHFTKINS
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
ttgaataagatattagcaattggtactgaaattgcacctgtgataggagcagttgcttcg
attggtgtaaaagcattgtataataattctaaatcatttagaaatgttataagtagtaca
ggaaatgtaattaacaatattgataaacattttacaaaaataaatagttag

DBGET integrated database retrieval system