KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1711Help
Entry
SAK_1711          CDS       T00278                                 

Definition
(GenBank) hypothetical protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABA45554
Position
complement(1700504..1700629)
Genome map
AA seq 41 aa AA seqDB search
MKTEIETNNLINLGWFHDNAVYYDMKTKKLYKSNLKKIAQV
NT seq 126 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaacggaaatagaaacaaataatcttattaatttaggatggtttcatgataatgct
gtttattatgatatgaaaacgaaaaaattatataaatctaatctaaaaaaaatagcacag
gtataa

DBGET integrated database retrieval system