KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1721Help
Entry
SAK_1721          CDS       T00278                                 

Gene name
ssb1
Definition
(GenBank) single-strand binding protein 1
  KO
K03111  single-strand DNA-binding protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak03030  DNA replication
sak03430  Mismatch repair
sak03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAK_1721 (ssb1)
   03430 Mismatch repair
    SAK_1721 (ssb1)
   03440 Homologous recombination
    SAK_1721 (ssb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sak03032]
    SAK_1721 (ssb1)
   03400 DNA repair and recombination proteins [BR:sak03400]
    SAK_1721 (ssb1)
   03029 Mitochondrial biogenesis [BR:sak03029]
    SAK_1721 (ssb1)
DNA replication proteins [BR:sak03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    SAK_1721 (ssb1)
DNA repair and recombination proteins [BR:sak03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     SAK_1721 (ssb1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SAK_1721 (ssb1)
Mitochondrial biogenesis [BR:sak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    SAK_1721 (ssb1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB tRNA_anti-codon tRNA_anti_2
Motif
Other DBs
NCBI-ProteinID: ABA44885
Position
complement(1710344..1710835)
Genome map
AA seq 163 aa AA seqDB search
MINNVVLVGRMTRDAELRYTPSNQAVATFSLAVNRNFKNQSGEREADFINCVIWRQQAEN
LANWAKKGALVGITGRIQTRNYENQQGQRVYVTEVVAESFQLLESRATREGGSPNSYNNG
GYNNAPSNNSYSASSQQTPNFSRDESPFGNSNPMDISDDDLPF
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgattaataatgtagtacttgtaggtcgcatgacccgtgatgcagaacttcgttataca
ccaagtaatcaagcggtagccactttttcacttgcagttaatcgtaattttaaaaatcaa
tctggcgaacgtgaggctgattttattaactgtgttatttggcgccaacaagctgaaaac
ttggctaactgggcaaaaaaaggtgctttggttggaattacaggtcgtatccaaacgcgt
aattatgaaaaccaacaaggtcaacgtgtctatgtaacagaagttgttgcggaaagtttc
caattattggaaagtcgtgctacacgagaaggtggttcacctaactcttataataacggt
ggctataacaatgctccgtcaaataatagttattcagcttcttctcaacaaacacctaat
tttagtcgtgatgagagtccgtttggtaactcaaatccaatggatatttcagatgatgat
ctaccattctaa

DBGET integrated database retrieval system