KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1722Help
Entry
SAK_1722          CDS       T00278                                 

Gene name
rpsF
Definition
(GenBank) ribosomal protein S6
  KO
K02990  small subunit ribosomal protein S6
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak03010  Ribosome
Module
sak_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sak00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAK_1722 (rpsF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sak03011]
    SAK_1722 (rpsF)
   03029 Mitochondrial biogenesis [BR:sak03029]
    SAK_1722 (rpsF)
Ribosome [BR:sak03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    SAK_1722 (rpsF)
  Bacteria
    SAK_1722 (rpsF)
Mitochondrial biogenesis [BR:sak03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SAK_1722 (rpsF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6 AbiJ_NTD3
Motif
Other DBs
NCBI-ProteinID: ABA46282
UniProt: Q3JZI0
Position
complement(1710847..1711134)
Genome map
AA seq 95 aa AA seqDB search
MAKYEILYIIRPNIEEEAKNALVARFDSILSDNGATVVESKDWEKRRLAYEIQDFTEGLY
HIVNVEAEDAVALNEFDRLSKINGDILRHMIVKVD
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatacgaaattctttatattattcgtccaaacattgaagaagaagctaaaaac
gctttggtagcacgttttgattctatcttatctgacaacggtgcaactgttgttgaatca
aaagattgggaaaaacgtcgtcttgcatacgaaatccaagatttcactgaaggactttac
catatcgttaacgttgaagctgaagatgcagtagctcttaatgagtttgatcgtctttca
aaaatcaacggtgacattcttcgtcacatgatcgttaaagtagactaa

DBGET integrated database retrieval system