KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1724Help
Entry
SAK_1724          CDS       T00278                                 

Definition
(GenBank) DNA-binding protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 Sigma70_r4 HTH_26 YdaS_antitoxin Phage_CI_repr DUF4044 HTH_11 HTH_37 HTH_28 MarR DUF3784 DUF2207
Motif
Other DBs
NCBI-ProteinID: ABA45437
Position
1713529..1714122
Genome map
AA seq 197 aa AA seqDB search
MEIGQQIIRYRKQQALSQEELAEKVYVSRQSISNWENDKTYPDIHSLLLLSQIFQVSLDQ
LIKGDIEKMKYTITQVDKKNFERDTKVMVTLMILLMISSYPLVYFLEWLGLGIFVLLSII
TMTYANRVERFKKKYDVQTYKEILAVSSGKLLDEIEKREERAKLPYQKPLIVTVFFLITV
ATFFASRFIFTWLFHLS
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggaaattggtcagcaaattattcgctaccgtaaacaacaagcgctctcgcaagaagaa
ttagccgagaaagtctatgtaagccgtcagagcatatctaactgggaaaatgacaaaact
tacccagacatccatagcctcttactcctaagtcaaatttttcaagtgagcttagaccaa
ctaattaaaggagacattgagaaaatgaaatataccatcactcaggttgataaaaagaat
tttgaacgagataccaaagtaatggtgacattgatgatactattaatgatttcaagttat
ccattagtctatttcttagagtggctaggacttggcatttttgttttattatcgataatt
actatgacttatgctaatcgtgtggaacgttttaagaaaaaatatgatgtgcaaacttat
aaggaaatcctagctgtttcaagtggaaaattattagacgaaatcgaaaaacgggaagaa
agagcaaaacttccttatcagaaaccccttattgtcactgtatttttcctcattactgtt
gccaccttttttgcaagtcgttttattttcacatggttgttccatttaagttag

DBGET integrated database retrieval system