KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1727Help
Entry
SAK_1727          CDS       T00278                                 

Definition
(GenBank) MutS2 family protein
  KO
K07456  DNA mismatch repair protein MutS2
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    SAK_1727
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sak03400]
    SAK_1727
DNA repair and recombination proteins [BR:sak03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Mismatch and loop recognition factors
     SAK_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MutS_V Smr HisKA PHA_synth_III_E AAA_14 Peptidase_S29 CmlA_N
Motif
Other DBs
NCBI-ProteinID: ABA44913
UniProt: Q3JZH6
Position
complement(1715067..1717406)
Genome map
AA seq 779 aa AA seqDB search
MNNKILEQLEFNKVKELILPYLKTEQSQEELSELEPMTEAPKIEKSFNEISDMEQIFVEH
HSFGIVSLSSISESLKRLELSADLNIQELLAIKKVLQSSSDMIHFYSDLDNVSFQSLDRL
FENLEQFPNLQGSFQAINDGGFLEHFASPELERIRRQLTNSERRVRQILQDMLKEKAELL
SENLIASRSGRSVLPVKNTYRNRISGVVHDISSSGSTVYIEPRAVVTLNEEITQLRADER
HEESRILHAFSDLLRPHVATIRNNAWILGHLDFVRAKYLFMSDNKATIPEISNDSTLALI
NVRHPLLSNPVANDLHFDQDLTAIVITGPNTGGKTIMLKTLGLAQLMGQSGLPVLADKGS
KIAVFNNIFADIGDEQSIEQSLSTFSSHMTHIVSILNEADHNSLVLFDELGAGTDPQEGA
SLAMAILEHLRLSNIKTMATTHYPELKAYGIETNFVENASMEFDAETLSPTYRFMQGVPG
RSNAFEIASRLGLAPFIVKQAKQMTDSDSDVNRIIEQLEAQTLETRRRLDHIKEVEQENL
KFNRAVKKLYNEFSHERDKELEKIYQEAQEIVDMALNESDTILKKLNDKSQLKPHEIIDA
KAQIKKLAPQVDLSKNKVLNKAKKIKAARAPRIGDDIIVTSYGQRGTLTSQLKDGRWEAQ
VGIIKMTLTQDEFTLVRVQEEQKVKSKQINVVKKADSSGPRARLDLRGKRYEEAMQELDN
FIDQALLNNMGQVDIIHGIGTGVIREGVTKYLRRNKHVKHFAYAPQNAGGSGATIVTLG
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaagattttagaacagttagaatttaacaaagttaaggaattgatattacct
tatctcaagacagaacaatcacaagaagaattatcagagctggagccgatgacggaggct
cctaaaatagaaaaaagttttaatgaaatttctgacatggaacagatttttgttgaacat
cactcatttggcatagtcagcctaagttcaatctctgagagtttaaaacgcttagagctt
tcagctgatcttaatattcaagaacttttggctatcaaaaaagttttacagagttcttcg
gatatgattcacttttattctgatttggataatgtttctttccaatctttggatcgtttg
tttgaaaatttggaacaattccctaatctgcaagggtcttttcaagctatcaatgatggt
ggttttttagaacattttgcgagtccagaattagagcgtatccgtcgtcaattaacaaac
agtgaacgacgggttcgtcagattttacaggatatgcttaaggaaaaagcagagctttta
tcagagaatctaatcgctagtcgtagtggacgaagtgtcctaccagtaaaaaatacttat
cggaatcgtatttctggtgtggttcatgacatctcttcttcaggaagtactgtttatatt
gagcctcgtgctgtagttacactaaacgaagagataacgcagcttagagctgacgaacgt
catgaagaaagtcgtattttacacgcattttcagacttgttaagaccccatgtcgccact
attagaaataatgcatggattcttgggcatcttgattttgtaagggctaaatatcttttt
atgtctgataataaggcgacgatacctgagatttctaatgacagcacgttagcattaatc
aatgttcgtcatcctctgttaagtaaccctgtggctaatgacttacattttgatcaagat
ttaactgcaattgtcatcactggtcccaatactggtggtaagacgattatgctaaaaaca
ctcggtttagcacaattaatgggacagtctggtttgccagtattagcggataaaggtagt
aaaattgcagtatttaacaatatctttgcagatattggcgatgagcaatctattgaacaa
agtctatcaactttttctagtcatatgacgcacatagtcagtattttaaacgaggctgac
cacaatagtttagtcctctttgatgaactgggagcaggaacggatcctcaagaaggtgct
agtttggctatggctattttagaacaccttaggttaagtaatatcaaaacgatggcgacc
acgcactatccagaattaaaagcttatgggattgagacaaattttgtagagaatgcgagc
atggaatttgatgccgaaacgcttagccctacgtatcgctttatgcaaggagttcctgga
cgatcaaatgcatttgaaattgcttctcgccttggtttagctccatttattgttaaacaa
gctaagcagatgacagattctgactcagatgttaaccgtattattgaacagttagaggca
cagacacttgagacacgtagaagactggatcatattaaagaagttgaacaagaaaacctc
aaattcaatcgtgcggttaagaaactctataatgaattttcacatgagcgcgataaagag
ttagaaaaaatctatcaagaagctcaagaaattgtagatatggctttgaatgagagtgat
actatcttaaaaaaactcaatgataagagccaattaaaacctcacgaaattatagatgct
aaggcacaaataaaaaaattagcacctcaagttgatttatcaaaaaataaagtcttaaat
aaggctaaaaaaattaaagcagctcgtgctcctagaattggtgatgatattatagtgact
agctatggacagcgaggtaccttaactagtcaattaaaagatggacgttgggaagcacaa
gtgggaattatcaaaatgacattaacacaagatgaatttacccttgttagagtccaagaa
gaacagaaagtcaaaagtaaacagattaatgtggttaaaaaggctgatagttctggacca
agagctcgacttgatcttagaggtaaaagatacgaagaagctatgcaagagttagataat
tttattgatcaagcattgcttaacaatatgggacaagttgatatcattcatggtattggt
acaggcgttatccgtgagggagtgacaaaatatcttcgtcgtaataagcacgttaagcat
tttgcttatgccccacaaaatgcagggggatctggcgccacaattgtaacgttagggtaa

DBGET integrated database retrieval system