KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1729Help
Entry
SAK_1729          CDS       T00278                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ZapA
Motif
Other DBs
NCBI-ProteinID: ABA46069
Position
complement(1718036..1718347)
Genome map
AA seq 103 aa AA seqDB search
METKINNSQKNRYKFVFGDKPLTLTTDKDNLFMEEIERVATEKYEAIKEKLPNADNETIA
ILMAINALSVQLSREIDIEKMEDELNKLRSKTISDIKEKVSED
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaataaataatagtcagaaaaatcgttataaatttgtctttggagataag
cctctcacattgacgacagataaagacaacctttttatggaagagattgagcgtgtagct
acagaaaagtatgaagctattaaagaaaaattacctaatgctgataatgaaacgattgct
attctcatggcaattaatgctttatcagtgcaactaagtcgagaaattgacattgaaaaa
atggaagatgagctcaataagttacgctccaaaacgatttcggacattaaagaaaaagtg
agtgaggattaa

DBGET integrated database retrieval system