KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1742Help
Entry
SAK_1742          CDS       T00278                                 

Definition
(GenBank) major facilitator family protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like BatA MFS_4
Motif
Other DBs
NCBI-ProteinID: ABA45191
Position
complement(1731546..1732748)
Genome map
AA seq 400 aa AA seqDB search
MEDKLFNKHFIGITILNFIVYMVYYLFTVIIAFIATKELGVSTSQAGLATGIYIVGTLIA
RLIFGKQLEVLGRKLVLRGGAIFYLLTTLAYFYMPSIGVMYLVRFLNGFGYGVVSTATNT
IVTAYIPADKRGEGINFYGLSTSLAAAIGPFVGTFMLDNLHINFKMVIVLCSILIAIVVL
GAFVFPVKNITLNPEQLAKSKSWTIDSFIEKKAIFITIIAFLMGISYASVLGFQKLYTTE
INLMTVGAYFFIVYALVITLTRPSMGRLMDAKGDKWVLYPSYLFLTLGLALLGSAMGSVT
YLLSGALIGFGYGTFMSCGQAASIKGVEEHRFNTAMSTYMIGLDLGLGAGPYILGLVKDG
FLGAGVQSFRELFWIAAIIPVVCGILYFLKSSRQVETKTI
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
ttggaagacaaattattcaacaaacattttataggcattactatcttaaactttattgtt
tatatggtctattatttgtttaccgttatcatagcttttattgcgactaaagagttaggt
gttagcactagccaagcaggattagcgacggggatttatattgtagggactttgattgct
cgtcttatatttggcaagcaattagaagttctaggacgtaagttagttttacgtggaggg
gctattttttacttactaacaactttagcttatttttatatgccaagtatcggagtaatg
tatttagttcgtttcctaaatggttttggttatggcgtcgtgtcaacagcaactaatact
attgtaacagcttatataccagctgataaaagaggtgaggggattaacttttacggtcta
tcaacaagtttagccgcagctattggtccttttgtaggaacatttatgctagacaacctt
catattaactttaaaatggttattgtattatgtagtattttaattgcgattgtagtgttg
ggagcatttgttttcccagtcaaaaatattactttaaatccagaacagttagctaaatca
aaatcatggactattgatagtttcattgagaaaaaagcaatttttatcacaattattgca
tttttgatgggtatctcctatgcttccgtgttaggtttccaaaaattatatacaacagaa
attaatttgatgacagtaggagcttatttctttattgtttatgcacttgtcatcacttta
accagaccatctatgggaagattaatggacgctaagggagataagtgggtgctttatcca
agttatctgttcttaactttgggacttgctttattagggagtgctatgggaagtgttacc
taccttctatcaggtgctttgattggttttggttatggtacctttatgtcttgtggccaa
gcagcatcaatcaaaggtgttgaggaacatcgtttcaatacagccatgtcaacttacatg
ataggtcttgatttagggttaggtgctggaccttacattttgggacttgttaaagatggt
tttcttggagctggtgtgcaatcctttagagaattattctggatagcagcgattattcct
gttgtttgtggtattctatatttcttaaaatcatctagacaagttgaaactaaaactata
taa

DBGET integrated database retrieval system