KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1744Help
Entry
SAK_1744          CDS       T00278                                 

Gene name
pepX
Definition
(GenBank) Xaa-Pro dipeptidyl-peptidase
  KO
K01281  X-Pro dipeptidyl-peptidase [EC:3.4.14.11]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Brite
KEGG Orthology (KO) [BR:sak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sak01002]
    SAK_1744 (pepX)
Enzymes [BR:sak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.11  Xaa-Pro dipeptidyl-peptidase
     SAK_1744 (pepX)
Peptidases [BR:sak01002]
 Serine Peptidases
  Family S15
   SAK_1744 (pepX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S15 PepX_N PepX_C Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ABA44432
UniProt: Q3JZF9
Position
1733587..1735872
Genome map
AA seq 761 aa AA seqDB search
MRYNQFSYIPTKPNEAFEELKGLGFPLNKKNSDKANLEAFLRHSFLNQTDTDYALSLLIV
DAKTDALTFFKSNSDLTLENLQWIYLQLLGFVPFVDFKDPKAFLQDINFPVSYDNIFQSL
HHLLACRGKSGNTLIDQLVADGLLHADNHYHFFNGKSLATFNTNQLIREVVYVETSLDTM
SSGEHDLVKVNIIRPTTEHTIPTMMTASPYHQGINDPAADQKTYQMEGALAVKQPKHIQV
DTKPFKEEVKHPSKLPISPATESFTHIDSYSLNDYFLSRGFANIYVSGVGTAGSTGFMTS
GDYQQIQSFKAVIDWLNGKVTAFTSHKRDKQVKADWSNGLVATTGKSYLGTMSTGLATTG
VEGLKVIIAEAAISTWYDYYRENGLVCSPGGYPGEDLDVLTELTYSRNLLAGDYIKNNDC
YQALLNEQSKAIDRQSGDYNQYWHDRNYLTHVNNVKSRVVYTHGLQDWNVKPRHVYKIFN
ALPQTIKKHLFLHQGQHVYMHNWQSIDFRESMNALLSQELLGIDNHFQLEEVIWQDNTTE
QTWQVLDAFGGNHQEQIGLGDSKKLIDNHYDKEAFDTYCKDFNVFKNDLFKGNNKTNQIT
INLPLKKNYLLNGQCKLHLRVKTSDKKAILSAQILDYGPKKRFKDTPTIKFLNSLDNGKN
FAREALRELPFTKDHYRVISKGVLNLQNRTDLLTIEAIDPEQWFDIEFSLQPSIYQLSKG
DNLRIILYTTDFEHTIRDNASYSITVDLSQSYLTIPTNQGN
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgcgttataatcaattcagctacattccaactaaacctaacgaagcttttgaagagcta
aaaggactaggttttccattaaacaaaaagaattctgataaagctaatttggaagctttt
ctcagacattcttttttaaatcaaactgatactgattacgctcttagtctccttatcgtt
gatgcaaaaaccgatgctctaaccttttttaaatcaaatagtgacttaacactagaaaat
ttacaatggatttatttacagttattaggctttgtcccctttgtagactttaaagaccct
aaagctttcttacaagatattaacttcccagtctcatatgacaatatttttcaaagtcta
catcacttactcgcctgtcgtggaaaatctggcaatacattaatcgaccaattagttgct
gatggtttacttcatgcagataatcactaccattttttcaatgggaagtctctggccact
ttcaatactaaccaattgattcgcgaagttgtctatgttgaaacatccttagatactatg
tctagtggtgaacatgatttagtaaaagttaacattatcagacccactaccgagcatact
atccccacgatgatgacagctagcccctatcatcaaggtatcaatgatcctgccgcagac
caaaaaacataccaaatggagggtgcgctagcagttaaacagcctaaacacatacaagtt
gacacaaaaccatttaaagaagaagtaaaacatccttcaaaattacccatcagccctgca
actgaaagcttcacacacattgacagttatagtctcaatgactattttctttctcgtggt
tttgctaatatatacgtttcaggtgtgggtactgctggctctacgggtttcatgaccagt
ggggattaccaacaaatacaaagctttaaagcagtcattgattggttaaatggtaaggtt
actgcattcacaagtcataaacgagataaacaagtcaaggctgattggtcaaatggcctt
gtagcaaccacaggtaaatcttatctcggtaccatgtcaactggtttagcaacaactggc
gttgaggggctgaaagtcattatcgctgaagccgcaatctccacatggtatgattattat
cgagaaaatgggcttgtgtgtagtccaggcggctaccccggtgaagatttagacgtttta
acagaattaacatactcacgaaacctcttagctggtgattacatcaaaaacaacgattgc
tatcaagcattgttaaatgaacaatcaaaagcaattgaccgtcaaagtggggattacaac
caatactggcatgaccgtaattacctaactcacgtcaataatgtcaaaagtcgagtagtt
tacactcatggactacaggattggaatgttaagccaagacatgtctacaaaattttcaat
gcattgcctcaaaccatcaaaaaacacctttttttacatcaaggtcaacatgtgtatatg
cataattggcagtcgattgattttcgtgaaagcatgaatgccttactaagccaagaacta
cttggcattgacaatcatttccaattagaagaggtcatttggcaagataatactactgag
caaacttggcaagttttagatgctttcggaggaaaccatcaagagcaaattggcttaggt
gatagtaaaaaacttattgataaccattatgacaaagaagcctttgatacttattgtaaa
gacttcaatgtgttcaaaaatgatcttttcaagggaaataataaaaccaatcaaatcact
attaatcttcctctaaagaaaaattatctcctgaatggacagtgcaaactccatctacgt
gttaaaactagtgacaaaaaggccattttatcagcccaaatcttagactatggtcctaaa
aaacgattcaaagatacaccaaccatcaaattcttaaacagccttgataatggtaaaaat
tttgccagagaagctttacgtgaactcccgtttactaaagatcattatcgtgtcatcagt
aaaggtgtcttgaaccttcaaaatcgtacagacttacttacaattgaggctatcgatcca
gaacaatggtttgatatcgagtttagcctccaaccaagtatatatcaattgagtaaaggt
gataatctaaggattatcctttatacaactgattttgaacataccattcgagataatgct
agttactctataacagtagatttgagtcaatcttatttaactatcccaactaatcaagga
aattaa

DBGET integrated database retrieval system