KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1748Help
Entry
SAK_1748          CDS       T00278                                 

Gene name
cydD
Definition
(GenBank) ABC transporter, ATP-binding protein CydD
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sak00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SAK_1748 (cydD)
Transporters [BR:sak02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    SAK_1748 (cydD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane RsgA_GTPase SMC_N AAA_21 AAA_16 MMR_HSR1 AAA_29 AAA_24 AAA_15 AAA_23 DUF815 Mg_chelatase Dynamin_N Ac76
Motif
Other DBs
NCBI-ProteinID: ABA45961
Position
complement(1739087..1740805)
Genome map
AA seq 572 aa AA seqDB search
MLDKAVMRLSGIHKLLGLLAGLDVLQAIFIIGQAYYLSLSITGLWEGQKLSSQTVYILLF
MVSYLGRHVIDYIKNRKLDDFSTAQSSLLRRQLLDKLFDLGPKVVQEQGTGNVVTMALDG
VSLVENYLRLVLNKMINMSIIPWIILAYIFYLDIESGAILLIVFPLIIIFMIILGYAAQA
KADKQYESYQVLSNHFLDSLRGIDTLKYFGLSKRYGKSIYQTSESFRKATMSTLKIGILS
TFALDFFTTLSIAIVAVFLGLRLLNEQIYLLPALTILILSPEYFLPVRDFSSDYHATLDG
KNAFQAIQKVLNKTGIKGEQLVIDDWSKESHLDLENIAIAYDQKRVVEDVTLRFRGHQKV
ALVGVSGSGKSSLINLLSGFLGPDKGSLKVDGREVVNLDQEDWHKQMIYIPQTPYVFEMS
LRDNITFYTPNASDEEVIRAIHMVGLDSLLSELPDGLETRIGNGARPLSGGQAQRIALAR
AFLDQNRRIMVFDEPTAHLDIETELELKEKMLPLMSDRLVIFATHRLHWLNQMDVIVVME
KGRVAEVGSYQELLAKKGYLYQLKHAMGGNNV
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgctagataaagcggttatgcgcttgtcaggtattcataagttgttaggattgcttgcg
ggacttgatgttcttcaagcaatctttattatcggacaagcttattatttgagtctttct
ataactggtttgtgggaagggcaaaaactttcttctcaaacggtttatattttgttattt
atggtctcatatttaggccgtcatgttattgattacatcaaaaatagaaaacttgatgac
ttttcaacagcacaatctagtcttttgagacgtcaattattagataagttatttgatcta
ggtcctaaagtcgttcaagaacaaggaactggtaatgttgttacaatggcattagatggc
gtttctttagttgaaaattatttacgtttagtcttgaataagatgattaacatgtctatt
atcccatggattattctagcttatattttctatttagatattgaatcaggtgcaatttta
cttatcgtttttcctttaattatcatctttatgattattttaggctatgcggctcaagct
aaagcagataaacaatatgaatcctatcaagtactttctaatcattttttagattcatta
cgaggcattgatactctcaaatattttggtcttagtaaacgttatggtaaaagcatttat
caaactagtgaatcttttcgtaaagcaacaatgagtactttgaaaattggtattttatca
acgtttgctttagacttttttacaactttatccattgctatcgttgctgtttttctaggt
ttacgattattaaatgagcagatttaccttttaccggctttaacaattttgattttatcc
cctgaatactttttacccgtaagagatttttctagtgattatcatgcaacgttagacggg
aaaaatgcatttcaagcgattcaaaaagttctaaacaaaactggtattaaaggtgagcaa
ttagtcatagatgattggtctaaagagagtcatttggatttagaaaacattgctattgcg
tacgaccaaaaacgtgttgttgaggatgtaaccttacgatttagaggacatcaaaaggtt
gctttagtaggagttagtggttcaggtaagtctagcttaattaaccttctgagtggtttt
ttagggcctgataaaggttctttaaaagtggatggtagagaagtggttaaccttgatcaa
gaagattggcataaacagatgatctatattcctcaaactccttatgtttttgaaatgtca
ttacgtgataatattaccttctatactcccaatgctagtgacgaagaggtgataagagcg
attcatatggtaggtttagatagcttactaagcgagttacccgatggtttagaaacgcgt
attggtaatggagcgcgtccacttagtggaggacaagcccagcgtatagctctggctcgt
gcttttcttgatcaaaatcgtcgtattatggtttttgatgaaccaactgctcatttagat
attgaaacagagttagaattaaaagagaaaatgttgccactgatgtcagatcgtttagtt
atctttgcaactcatcgtcttcactggttgaaccaaatggatgttatagtcgttatggag
aaggggagagttgcagaagtaggctcttatcaggaattattagctaaaaaaggatatctc
tatcaactgaagcatgctatgggaggaaataatgtttaa

DBGET integrated database retrieval system