KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1752Help
Entry
SAK_1752          CDS       T00278                                 

Definition
(GenBank) prenyltransferase, UbiA family
  KO
K02548  1,4-dihydroxy-2-naphthoate octaprenyltransferase [EC:2.5.1.74 2.5.1.-]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00130  Ubiquinone and other terpenoid-quinone biosynthesis
sak01100  Metabolic pathways
sak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    SAK_1752
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:sak01006]
    SAK_1752
Enzymes [BR:sak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.74  1,4-dihydroxy-2-naphthoate polyprenyltransferase
     SAK_1752
    2.5.1.-  
     SAK_1752
Prenyltransferases [BR:sak01006]
 Compound prenylation
  DHNA octaprenyltransferase
   SAK_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-ProteinID: ABA44856
Position
complement(1744576..1745475)
Genome map
AA seq 299 aa AA seqDB search
MTLPIFLELVEMKAKTASVLPFLIGLCFSAYYYNSVHPVYVGLFFVAMFLFNMFVDIWNN
YNDYRNAVDLDYKNDTNIIGRENLSLRQIEVIMASLVITSSMIGLVLVSQVGLPLLWMGL
FCFGIGVLYSFGPRPLSSLPLGEVFSGLTMGFMISLICVYLNTYQNFSWDILNLSKIFLI
SLPNTLWIANLMLANNLCDKEEDEKNHRYTLVHYTGIRGGLLLFAISNSIALLAIVFEFL
FGLAPVTVLLSLLLIPFIYKQTKLLWQKQVKRETFVCAVRILALGSATQVLTYLIGIIF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacattaccaatctttctagagttggtagaaatgaaagccaaaacagctagtgtttta
ccatttttgattggtttgtgttttagtgcttattactacaattcagtacaccctgtatat
gtcggtttattcttcgttgctatgtttttattcaatatgttcgttgacatttggaataat
tacaatgattatcggaatgctgtggatttggattataagaatgacactaacattattggt
cgtgagaacctatccctacgccaaatagaagttattatggcaagtttagtcattacttct
agtatgattggtttagttttagtttcccaagtcggtctgcctcttttatggatgggactt
ttttgttttggaattggtgttttatattcctttggtccaagacctttatctagtctgccc
ttaggagaagtattttctggcttgacaatgggatttatgattagtttaatttgtgtatat
ctaaacacttatcaaaacttttcgtgggatatcctcaacttaagcaaaattttcttgatt
tccttgccgaacaccttatggattgccaacctaatgttggcgaataatctgtgcgacaaa
gaagaagatgaaaaaaatcatcgctatacccttgtacattatacagggataagaggtgga
ctcttgctgtttgctatttctaatagtatagctttattggcaattgtttttgaatttctt
tttggacttgcgcctgttacagtactcttgagtttgttattaataccatttatttataag
cagacaaaactattgtggcaaaaacaggttaagagagaaacatttgtttgtgcggtacgt
attctagcactgggatctgcaacccaagtcttaacgtatctaattggaatcattttttag

DBGET integrated database retrieval system