KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1756Help
Entry
SAK_1756          CDS       T00278                                 

Gene name
tkt
Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00030  Pentose phosphate pathway
sak01100  Metabolic pathways
sak01110  Biosynthesis of secondary metabolites
sak01120  Microbial metabolism in diverse environments
sak01130  Biosynthesis of antibiotics
sak01200  Carbon metabolism
sak01230  Biosynthesis of amino acids
Module
sak_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAK_1756 (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    SAK_1756 (tkt)
Enzymes [BR:sak01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     SAK_1756 (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: ABA45601
Position
complement(1751340..1753325)
Genome map
AA seq 661 aa AA seqDB search
MTFDAVDQLAVNTVRTLSMDAIQAANSGHPGLPMGAAPMAYVLWNKYMNINPKTSRNWTN
RDRFILSAGHGSAMLYSLLHLAGYDLSIDDLKNFRQWGSKTPGHPEVNHTDGVEATTGPL
GQGIANAVGMAMAEAHLAAKYNKPGFNIVDHYTFALNGDGDLMEGVSQEVASLAGHLKLG
KLITLYDSNDISLDGPTSMAFTEDVKGRFEAYGWQHILVKDGNDLDAIAKAIEEAKAETE
KPTIIEVKTIIVFGSEKQGTSAVHGAPLGAEGIVFTKNAYKWTYEDFIVPDEVKARFQEG
LQARGEQAENAWNELFAKYEAEYPELAKGYKEVFSNEPVSVELAAHELGSSKASRVSSQE
AIQQISEQVASFWGGSADLSASNNTMVKVEKDFQPGQYEGCNIWFGVREFAMAAAMNGIA
LHGGTRVYGGTFFVFSNYLLPAVRMAALQSLPTMYVMTHDSIAVGEDGPTHEPIEQLASV
RSMPNLNVIRPADGNETNAAWKHALAEIDKPTMLVLTRQNLPVLEGTKELAEEGLNKGAY
ILSEAKGEMDGIIIATGSEVKLAMDTQAALAEEGIHVRVVSMPSQNIFDAQSDAYKEEIL
PATITKRLAIEAASSFGWAKYVGLAGKTLTIDTWGASAPGNRIFEEYGFTTENATVLYKA
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgacattcgatgcagttgaccagttggcagtaaacactgtccgtacgctttcaatggat
gctatccaagcagctaattcaggccaccccggtttaccaatgggggcagctccaatggct
tatgttctatggaataaatacatgaacattaatcctaaaacaagccgtaactggacaaac
agagaccgttttattctttctgcaggacatggatctgcaatgctatacagcttattacat
ttagctggttacgacctttcaatcgatgatttgaaaaatttccgtcaatggggttcaaaa
acgccaggacatcctgaagtcaatcatacagatggtgtagaagcaacaacaggaccgcta
ggacaaggtatcgcaaacgctgtaggtatggcaatggcagaagctcaccttgctgcaaaa
tacaacaaaccaggtttcaatatcgttgaccattatacttttgctttaaatggtgatggt
gacttaatggaaggtgtcagtcaagaagtcgcaagtttagcaggtcacttaaaacttgga
aaattaatcactttatatgattcaaatgacatttctctagatggccctacatctatggcc
ttcactgaggatgttaaaggacgttttgaagcttatggatggcaacatatcctcgttaaa
gacggcaatgacttagatgctattgccaaagctatcgaagaggcaaaagctgaaactgaa
aaaccaactattattgaagttaaaacaattattgtttttggatctgaaaaacaaggaact
tcagcagttcatggtgccccacttggagcagaaggcattgtctttactaaaaatgcttac
aaatggacctatgaagatttcatcgttcctgacgaagtgaaagctcgtttccaagaagga
ttacaagcacgtggtgaacaagctgaaaatgcttggaatgaactctttgcaaaatatgaa
gcggaatatccagaacttgctaaaggctataaagaagtcttttcaaatgaaccagtttca
gtagaattagctgcgcatgaacttgggtcatcaaaagctagccgtgtttcaagtcaagag
gctatccaacaaatctctgaacaagtcgcatcattctggggtggttcggcagacctttca
gcctcaaacaacacaatggttaaagttgaaaaagacttccaaccaggtcaatatgaaggc
tgcaatatctggtttggtgtacgtgaatttgccatggcagctgcgatgaacggtattgct
cttcatggtggtactcgcgtttatggtggtacattcttcgtcttctcaaactatctatta
cctgcagtacgtatggcagcactgcaaagcttaccaaccatgtatgtcatgacacatgac
tccattgccgttggtgaagacggtccaactcatgaaccaattgaacagttagcaagtgtc
cgttcaatgccaaacttgaacgtcattcgtccagcggatggtaatgaaaccaatgccgca
tggaaacatgccttagcagaaatagataaaccaacaatgctagtgttaacacgacaaaac
ttgccagttcttgaaggaacaaaagaattagcagaagaaggtttaaataagggtgcttat
atcttgtcagaagccaaaggcgaaatggatggtatcatcattgcgacgggatctgaagta
aaattagccatggatacacaggctgcgctagcagaagaagggatccatgttcgtgttgta
tcaatgccatcacaaaatatctttgatgcgcaaagcgacgcttataaagaagagatttta
ccagccacaatcacaaaacgcttggcaattgaagcagcatcaagctttggttgggcaaaa
tatgtaggcttagctggcaaaaccttaaccattgacacatggggagcttcggcaccagga
aatcgtatctttgaagaatatggtttcacaacagaaaatgctacagtcctatataaagca
ttataa

DBGET integrated database retrieval system