KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1758Help
Entry
SAK_1758          CDS       T00278                                 

Definition
(GenBank) D-allulose-6-phosphate 3-epimerase
  KO
K17195  D-allulose-6-phosphate 3-epimerase [EC:5.1.3.-]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00051  Fructose and mannose metabolism
sak01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAK_1758
Enzymes [BR:sak01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     SAK_1758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: ABA46349
Position
complement(1754036..1754725)
Genome map
AA seq 229 aa AA seqDB search
MQKVEISPSLMCMNLDKFQEEICFLDSHVDSYHIDIMDGHFVPNITLSPWFVEEVRKLSS
LPMSAHLMVKDQPFWVQQMIDIKCEWICMHAEVINGLAFRLIDQIHNEGLKAGVVLNPET
PIEVIMPYIELLDKVTIMTVDPGFAGQRFLDSTLDKIVDLRRLREENNYNYLIEMDGSSS
RKTFKKIDEAGPDIYIVGRSGLFALTDNISESWDIMTNDYFEMTGKKLN
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagtagaaatatctccctcgttgatgtgtatgaatcttgacaaattccaagaa
gaaatctgttttttagattcacatgttgattcctaccatattgatataatggatggacat
tttgtacctaatattacactgtctccttggtttgtggaagaagttagaaagctatcctcc
ttaccaatgtcagctcatttgatggtaaaagatcaaccgttttgggtgcaacaaatgatt
gatataaaatgtgaatggatttgtatgcatgctgaagtgataaatggtctggcgtttagg
ttaattgatcaaattcataatgaaggtttaaaagcaggggtagttttaaatcccgaaacc
cctattgaagtaataatgccctatattgaactgttagataaagttactattatgacagtg
gatcctggttttgctggacaaaggtttttagattcaactttagataaaattgtagatcta
agaagattgagagaagaaaataattataattacttaattgagatggatggttcatctagc
cgtaaaacatttaaaaaaattgatgaggctggccctgatatatacattgttggacgaagt
ggtttattcgcattaacagataatatttcagaatcatgggacattatgaccaatgactac
tttgaaatgactggaaaaaaattaaactag

DBGET integrated database retrieval system