KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1761Help
Entry
SAK_1761          CDS       T00278                                 

Definition
(GenBank) PTS system, fructose-specific, IIB component
  KO
K02769  PTS system, fructose-specific IIB component [EC:2.7.1.202]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00051  Fructose and mannose metabolism
sak01100  Metabolic pathways
sak01120  Microbial metabolism in diverse environments
sak02060  Phosphotransferase system (PTS)
Module
sak_M00273  PTS system, fructose-specific II component
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAK_1761
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SAK_1761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sak02000]
    SAK_1761
Enzymes [BR:sak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     SAK_1761
Transporters [BR:sak02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component [MD:M00273]
    SAK_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ABA45197
Position
complement(1756316..1756627)
Genome map
AA seq 103 aa AA seqDB search
MKIVGVAACTVGIAHTYIAQEKLENASKAAGHDVKIETQGTIGIENQLTSEEIAAADIVL
LAVDVKIAGEERFEGKKVVKVPTEVAIKSPNKLIAKLVEVASN
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttggagtagcagcatgtacagtaggaattgctcacacttatattgctcaa
gaaaaattggaaaatgcttcgaaagcagctggtcatgatgtcaagattgaaacacaaggg
acaattggtattgaaaatcaactaacatcagaagaaatagcagcagctgatattgttttg
ttagctgttgatgtaaaaattgctggtgaagaaagatttgaagggaaaaaagtagtaaaa
gttccaacagaagttgcgattaagtcacctaacaaattaatcgcaaaacttgtggaagtt
gcgtcaaattag

DBGET integrated database retrieval system