KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1773Help
Entry
SAK_1773          CDS       T00278                                 

Definition
(GenBank) exonuclease, putative
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00230  Purine metabolism
sak00240  Pyrimidine metabolism
sak01100  Metabolic pathways
sak03030  DNA replication
sak03430  Mismatch repair
sak03440  Homologous recombination
Module
sak_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAK_1773
   00240 Pyrimidine metabolism
    SAK_1773
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAK_1773
   03430 Mismatch repair
    SAK_1773
   03440 Homologous recombination
    SAK_1773
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sak03032]
    SAK_1773
   03400 DNA repair and recombination proteins [BR:sak03400]
    SAK_1773
Enzymes [BR:sak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAK_1773
DNA replication proteins [BR:sak03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAK_1773
DNA repair and recombination proteins [BR:sak03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     SAK_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051
Motif
Other DBs
NCBI-ProteinID: ABA44935
Position
complement(1767064..1767651)
Genome map
AA seq 195 aa AA seqDB search
MKQLQEYIAFDLEFNTVGEHSHIIQVSSVKYSNHQEIALFDTYVHTKVPLQSFINGLTGI
TARDIIGAPKIETVLTDFQSFVGDTPLIGYNGHKSDLPLLVENGLDLTSQYQVDLYDEAF
VRRSTDLNGIVNLKLTTVADFLGIKGKAHNSLEDARMTARVYEKFLDLDENKIYLKQQKE
VAVDSPFATLGNLFD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattacaagaatatatagcttttgatttagagtttaacacggttggtgagcat
agccatattattcaagtgtcgtccgttaaatattctaatcatcaagagattgctttattt
gatacttatgttcacacaaaagttccattacaaagctttattaatggtttaacaggtatt
acagctagagatattataggggctcctaaaattgagacagttttgacagactttcagagt
tttgttggagacacaccgctgattggttataatgggcataaatcggatttacctctttta
gttgaaaatggtttggatctaactagtcaatatcaggtggacttatatgatgaagctttt
gtgagacgtagtacagatttaaatggtattgtcaaccttaaattgactactgttgctgac
tttttaggaataaagggtaaggcacataatagcttagaggatgcccgcatgactgcgcgt
gtttatgaaaaatttctggacttggatgaaaataaaatctatttaaaacagcaaaaagag
gtagcagttgatagcccatttgcgactttaggaaatttgtttgattaa

DBGET integrated database retrieval system