KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1775Help
Entry
SAK_1775          CDS       T00278                                 

Definition
(GenBank) conserved hypothetical protein TIGR00275
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HI0933_like Pyr_redox_3 FAD_oxidored FAD_binding_2 Pyr_redox_2 GIDA DAO Pyr_redox FAD_binding_3 NAD_binding_8 AlaDh_PNT_C Mg-por_mtran_C
Motif
Other DBs
NCBI-ProteinID: ABA44752
Position
1768366..1769538
Genome map
AA seq 390 aa AA seqDB search
MKHYDTIIIGGGPAGMMAAISSNFYGNKTLLIEKNKRLGKKLAGTGGGRCNVTNNGNLDE
LLAGIPGNGRFLYSVFSQFDNHDIINFFQDNGVTLKEEDHGRMFPTTDKSRTIINALENK
IKELGGQIMTDTEVVSVKKIGDSFYIKTKDTQFASDKLVVTTGGKSYPSTGSTGFGHDIA
RHFKLEVTDMEAAESPLLTDFPHKKLQGISLDDVTLSFEKHIITHDLLFTHFGLSGPAAL
RISSFVKGGETIYLDVLPNISVKELETHFQNEREKSLKNALKILLPERLAEFYAEDLPEK
VKQVSVKDLETLIQKLKKLPILVTGKMSLAKSFVTKGGVDLKEINPKTLESKKVAGLHFA
GEVLDINAHTGGFNITSALCTGWVAGSLHY
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattatgacacaataattataggtggtggacctgctggaatgatggcagctatt
tcctcaaatttttacggcaacaaaacacttcttattgagaaaaataaacgtttaggcaaa
aaactagctggaacaggtggtggccgctgtaatgttaccaataatggaaaccttgatgag
ctcttagctggtatacctggaaatggccgtttcctatatagcgtcttctcacaatttgat
aaccatgatattattaacttctttcaagacaacggcgtcacacttaaagaagaagatcat
gggcgtatgttccctactactgataaatctcgtactatcattaacgcccttgaaaataaa
ataaaagaacttggtggtcaaattatgactgacacagaagttgtctctgtcaaaaagata
ggagattcattctatatcaaaactaaagatacacagttcgcatccgataaacttgtcgta
acaactggtggtaaatcctatccgtctacaggttctactggtttcggtcatgacattgct
cgtcactttaaattagaagtcacagatatggaagccgccgaaagccctcttttaactgat
tttccccataaaaaactacaaggtatctccttagatgatgtcactttgtcatttgaaaag
catattattacacacgatcttctctttactcattttggattatcaggaccagcagccttg
cgaatttccagctttgtcaaaggcggagaaactatatacctagatgttttgcccaatatc
tctgttaaagaattggaaacacacttccaaaatgaaagagaaaaatctttgaaaaacgct
cttaaaatacttcttcctgagcgtttagctgaattttacgctgaagacttacccgaaaaa
gtaaaacaagtatctgtaaaagacttagaaacgttaattcaaaaacttaaaaaacttcct
attttagtaactggcaagatgtctctagcaaaatcctttgtaacaaaaggtggagttgat
cttaaagaaataaaccccaaaacacttgaaagtaaaaaggtagctggtttacattttgct
ggtgaagtcctagacatcaatgctcatacgggagggtttaacattacttctgccttatgt
acaggctgggtagctggtagcttacactattaa

DBGET integrated database retrieval system