KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1779Help
Entry
SAK_1779          CDS       T00278                                 

Definition
(GenBank) metalloendopeptidase, putative, glycoprotease family
  KO
K01409  N6-L-threonylcarbamoyladenine synthase [EC:2.3.1.234]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Brite
KEGG Orthology (KO) [BR:sak00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sak03016]
    SAK_1779
Enzymes [BR:sak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.234  N6-L-threonylcarbamoyladenine synthase
     SAK_1779
Transfer RNA biogenesis [BR:sak03016]
 Eukaryotic Type
  tRNA modification factors
   KEOPS/EKC complex
    SAK_1779
 Prokaryotic Type
    SAK_1779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M22 Carbam_trans_N BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ABA45165
UniProt: Q3JZC7
Position
complement(1772296..1773306)
Genome map
AA seq 336 aa AA seqDB search
MKDRYILAVESSCDETSVAILKNDKELLANIIASQVESHKRFGGVVPEVASRHHVEVVTT
CFEDALQEAGIVASDLDAVAVTYGPGLVGALLVGMAAAKAFAWANKLPLIPVNHMAGHLM
AARDVKELQYPLLALLVSGGHTELVYVSEPGDYKIVGETRDDAVGEAYDKVGRVMGLTYP
AGREIDQLAHKGQDTYHFPRAMIKEDHLEFSFSGLKSAFINLHHNAEQKGEALVLEDLCA
SFQAAVLDILLAKTQKALLKHPVKTLVVAGGVAANQGLRERLATDISPDIDVVIPPLRLC
GDNAGMIALAAAIEFEKENFASLKLNAKPSLAFESL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatagatatattttagcagtggaaagttcatgtgatgaaactagtgttgctatt
ttaaaaaatgataaagaattactagctaatattattgcaagtcaagttgaaagtcacaaa
cgttttggtggtgttgttcctgaagtggcaagccgtcatcacgttgaagtagtaacaacc
tgttttgaggatgctcttcaagaagcaggtattgttgctagcgatttggatgctgttgct
gtaacatatggtccgggattagtaggagccttattggtaggtatggctgcagcaaaagct
ttcgcttgggcaaataaattacctctaattcctgtaaaccacatggcgggtcatttaatg
gcagcacgtgacgttaaggaacttcaatacccattgttagctttgcttgtcagtggagga
catacagaattagtatatgtttctgaaccgggagattacaaaatagtaggagaaactcgg
gatgatgctgttggagaagcttatgataaagtaggccgtgttatgggcttaacttatcca
gcaggtcgcgagattgatcagttagctcataagggtcaagatacttaccattttcctaga
gcgatgatcaaagaagatcatcttgaattttctttttctggattaaaatctgcatttatc
aatttacatcataatgcagaacaaaagggtgaagcattggttcttgaagatttatgtgct
tcctttcaggcggctgttttggatattttattggctaaaactcaaaaagctttgttaaag
catccagtgaaaactttagtcgttgctggtggagttgcagctaatcaaggacttcgggaa
cgcttggctactgatatttctcctgatattgatgtggttattcctcctcttagattatgt
ggggataatgcaggaatgattgcattagcagcagcgatagagtttgaaaaagagaatttt
gcttctttaaaattgaatgccaaacctagcttagcttttgagagtttatag

DBGET integrated database retrieval system