KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1782Help
Entry
SAK_1782          CDS       T00278                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1447 DUF1372
Motif
Other DBs
NCBI-ProteinID: ABA46105
UniProt: Q3JZC4
Position
1774662..1774892
Genome map
AA seq 76 aa AA seqDB search
MIYKVFYQETKERNPRREQTKTLYVTIDAANELEGRIAARKLVEENTAYNIEFIELLSDK
HLEYEKETGVFELTEF
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgatttataaagttttctatcaagaaacaaaagaacgcaacccacgtcgtgagcaaacc
aaaacactttacgttactattgatgcagctaatgaattagaaggtcgcattgctgcacgt
aaactagttgaagaaaatacagcttacaatatcgaattcatcgagttactttcagacaaa
caccttgaatatgaaaaagaaactggtgttttcgagctcactgagttctag

DBGET integrated database retrieval system