KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1783Help
Entry
SAK_1783          CDS       T00278                                 

Definition
(GenBank) metallo-beta-lactamase family protein
  KO
K12574  ribonuclease J [EC:3.1.-.-]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sak00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SAK_1783
Enzymes [BR:sak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     SAK_1783
Messenger RNA biogenesis [BR:sak03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     SAK_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B RMMBL Lactamase_B_2 SIS_2
Motif
Other DBs
NCBI-ProteinID: ABA44829
Position
1774946..1776625
Genome map
AA seq 559 aa AA seqDB search
MSNINLKPEEVGVYAIGGLGEIGKNTYGIEYQDEIIIVDAGIKFPEDDLLGIDYVIPDYS
YIVENIDRIKALVITHGHEDHIGGIPFLLKQANLPIYAGPLALALIKGKLEEHGLLRDAT
LYEIHANTELTFKNLSVTFFRTTHSIPEPLGIVIHTPQGKVICTGDFKFDFTPVGEPADL
HRMAALGEDGVLCLLSDSTNAEVPTFTNSEKIVGQSIMKIIEGIEGRIIFASFASNIFRL
QQAAEAAVKTGRKIAVFGRSMEKAIVNGIELGYIKVPKGTFIEPSELKHLHASEVLIMCT
GSQGESMAALARIANGTHRQVTLQPGDTVIFSSSPIPGNTTSVNKLINTIQEAGVDVIHG
KINNIHTSGHGGQQEQKLMLRLIKPEYFMPVHGEYRMQKVHAGLAVDTGIPKENIFIMEN
GDVLALTSDSARIAGHFNAQDIYVDGNGIGDIGAAVLRDRHDLSEDGVVLAVATVDFDSK
MILAGPDILSRGFIYMRESGDLIRESQHILFNAIRIALKNKDASIQSVNGAIVNALRPFL
YEKTEREPIIIPMVLTPDK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatatcaacttaaaacccgaagaagttggggtttatgcgattggtggtctcggt
gaaatcggaaaaaatacttacggtatcgaatatcaagacgaaattattattgtagacgct
ggtattaaattccctgaagatgatcttttgggaatagattatgttatcccagactattca
tatatcgttgaaaacattgaccgtatcaaggcccttgttataactcatgggcacgaggac
cacatcggtggtattccttttctattaaaacaagctaatttaccgatttatgcaggccct
ctcgctcttgctctaatcaaaggtaagttagaagaacatggtttacttcgtgacgctaca
ttatacgaaatccacgctaatacagagctgacttttaaaaacttaagcgttacatttttc
cgcactactcactccattcctgaaccattaggtattgttattcatacccctcaaggtaag
gttatttgtacaggtgacttcaaatttgactttacacctgttggggagcccgctgactta
catcgtatggctgctctaggtgaagacggtgtcctctgccttttatcagactcaacaaat
gctgaagttccaaccttcactaattccgaaaaaattgttgggcaatctattatgaagatt
atcgaaggtatcgagggacgtattattttcgcctcttttgcttcaaacatcttccgactc
caacaggctgctgaagctgctgttaaaactggtcgtaaaattgctgtttttggacggtca
atggaaaaggcaattgttaacggtattgaacttggctatattaaagttccaaaaggtacc
ttcattgagccaagcgaacttaaacatcttcatgctagtgaagttttaattatgtgtaca
ggtagtcaaggtgagtctatggcagcacttgctcgtatcgctaacggtactcatcgtcaa
gttactttgcaacctggtgatactgtgattttctcatcaagcccaatccctggtaataca
acaagtgtcaataaattaatcaataccattcaagaagctggtgtcgatgttattcatggt
aaaattaacaatatccatacctccggccatggtggtcaacaagaacaaaaattaatgtta
cgcttgattaaaccagagtatttcatgcccgtacacggtgagtatcgcatgcaaaaagtc
catgctggtttagcagttgacacaggtattcctaaagagaatatcttcattatggaaaac
ggtgatgttttagctttaacgagcgactctgctcgcattgctggacatttcaatgctcaa
gatatctacgttgatgggaatggtattggcgatattggtgcggcagttctacgtgaccgc
cacgacttatctgaagatggtgttgtccttgccgttgctaccgttgatttcgattcaaaa
atgattttagctggaccagacatccttagccgaggctttatctatatgagagaatctggg
gaccttattcgcgaaagccaacatatcttattcaatgctattcgtattgcactgaaaaat
aaagatgcaagtatccaatcagtaaatggagctattgttaatgccttacgaccattctta
tatgaaaaaactgagcgtgagcctatcattattcctatggtccttacccctgataaataa

DBGET integrated database retrieval system