KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1792Help
Entry
SAK_1792          CDS       T00278                                 

Gene name
rpsG
Definition
(GenBank) ribosomal protein S7
  KO
K02992  small subunit ribosomal protein S7
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak03010  Ribosome
Module
sak_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sak00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAK_1792 (rpsG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sak03011]
    SAK_1792 (rpsG)
Ribosome [BR:sak03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    SAK_1792 (rpsG)
  Bacteria
    SAK_1792 (rpsG)
  Archaea
    SAK_1792 (rpsG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S7
Motif
Other DBs
NCBI-ProteinID: ABA44861
UniProt: Q3JZB4
Position
complement(1785934..1786404)
Genome map
AA seq 156 aa AA seqDB search
MSRKNQAPKREVLPDPLYNSKIVTRLINRVMLDGKRGTAATIVYDAFEAIKEATGTDALE
VFETAMENIMPVLEVRARRVGGSNYQVPVEVRPERRTTLGLRWLVNASRARGEHTMKDRL
AKEIMDAANNTGASVKKREDTHKMAEANRAFAHFRW
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgtaaaaatcaagcgcctaaacgcgaagtattaccagatccattgtataactca
aaaatcgttacacgtcttatcaaccgtgtaatgcttgatggtaaacgtggtactgctgca
actatcgtatatgatgcttttgaagcaattaaagaagctactggaacagatgctcttgaa
gtattcgaaacagctatggaaaacatcatgcctgtacttgaggtacgcgcacgccgtgtt
ggtggatcaaactaccaagttcctgtcgaagttcgtccagaacgtcgtacaactttagga
cttcgttggttggttaacgcatcacgtgctcgtggtgaacacactatgaaagatcgtctt
gcaaaagaaatcatggatgctgcaaacaacacaggagcatcagttaagaaacgtgaagat
actcacaaaatggctgaagctaaccgtgcctttgcacacttccgttggtaa

DBGET integrated database retrieval system