KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1793Help
Entry
SAK_1793          CDS       T00278                                 

Gene name
rpsL
Definition
(GenBank) ribosomal protein S12
  KO
K02950  small subunit ribosomal protein S12
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak03010  Ribosome
Module
sak_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sak00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAK_1793 (rpsL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sak03011]
    SAK_1793 (rpsL)
Ribosome [BR:sak03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    SAK_1793 (rpsL)
  Bacteria
    SAK_1793 (rpsL)
  Archaea
    SAK_1793 (rpsL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: ABA46012
UniProt: Q3JZB3
Position
complement(1786426..1786839)
Genome map
AA seq 137 aa AA seqDB search
MPTINQLVRKPRKSKVEKSDSPALNIGYNSHRKVHTKLSAPQKRGVATRVGTMTPKKPNS
ALRKFARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGV
ADRKQGRSKYGAKRPKG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaattaaccagttggtacgtaaaccacgtaaatctaaagttgaaaaatcagat
tcacctgctttgaatattggttacaacagtcacagaaaagttcacactaaattatctgca
ccacaaaaacgtggtgttgcaactcgtgttggaactatgacacctaaaaaacctaactct
gcccttcgtaaatttgctcgtgtacgtttgagcaaccttattgaagttactgcttacatt
ccaggtatcggacacaacttgcaagaacacagtgttgtgcttatccgtggtggacgtgta
aaagaccttccaggggtacgttaccatatcgttcgtggtgcacttgatactgcaggtgta
gctgatcgtaaacaaggccgttctaaatacggtgctaaacgtcctaaagggtaa

DBGET integrated database retrieval system