KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1794Help
Entry
SAK_1794          CDS       T00278                                 

Gene name
purR
Definition
(GenBank) pur operon repressor
  KO
K09685  purine operon repressor
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Brite
Transcription factors [BR:sak03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SAK_1794 (purR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PuR_N Pribosyltran SpoIIID CPT DUF1697
Motif
Other DBs
NCBI-ProteinID: ABA44602
Position
complement(1787058..1787870)
Genome map
AA seq 270 aa AA seqDB search
MKLRRSERMVVISNYLINNPYTLTSLNTFASKYGAAKSSISEDIAIIKKAFEQAQIGDIK
TVTGASGGVIFTPTIAEAEAKEIVEELRQRLSENDRILPGGYIYLSDLLSTPKMLQSIGR
IIANAYRGQKIDAVMTVATKGVPLANAVANVLDVPFVIVRRDLKITEGSTVSVNYASGSS
GRIEKMFLSKRSLKPNSRVLIVDDFLKGGGTVSGMISLLSEFDSTLVGVAVFAENAQEQR
EKMAYKSLLRVSEIDVKNNRVSVEAGNIFD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagacgtagcgaacgcatggttgttatttcaaattacctaataaataatccc
tatacattaactagtttaaatacatttgctagtaaatacggtgccgcgaaatcttcgatt
tcagaagatattgctattatcaaaaaagcttttgaacaagctcaaatcggagatattaaa
actgtgactggtgcaagtggaggtgttatctttacaccaactattgctgaagcagaagcg
aaagaaatcgttgaagaattaagacagcgtttatctgaaaacgatcgtattcttccggga
ggttacatttatctttcagatctactcagtacaccaaaaatgttacaaagtattggtcgc
attatagcgaacgcttacagaggtcaaaaaattgatgctgtcatgacggttgcaacaaaa
ggtgttcctttagcaaacgcagtagcaaatgttttagatgttccttttgttattgtgaga
cgtgatttgaagattacggaaggttctactgtgtcagtaaactacgctagtggttcaagt
ggccgtattgaaaaaatgtttctttctaagcgtagcttaaaacctaacagtcgagtttta
atagttgatgatttcttgaaaggtggaggtactgtttcggggatgattagtttactctca
gaattcgatagcacattagtaggtgtcgctgtatttgcagaaaatgctcaggaacaacgt
gagaagatggcctataaatctcttctgagagtatctgaaattgatgtaaaaaataataga
gtctctgtagaagcggggaatatatttgattaa

DBGET integrated database retrieval system