KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1797Help
Entry
SAK_1797          CDS       T00278                                 

Definition
(GenBank) thiamine pyrophosphokinase
  KO
K00949  thiamine pyrophosphokinase [EC:2.7.6.2]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00730  Thiamine metabolism
sak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAK_1797
Enzymes [BR:sak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.2  thiamine diphosphokinase
     SAK_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPK_catalytic TPK_B1_binding PBECR3 RTC_insert
Motif
Other DBs
NCBI-ProteinID: ABA45056
Position
complement(1790174..1790806)
Genome map
AA seq 210 aa AA seqDB search
MTKIALFAGGDLTYFEYDFDYFVGIDRGSLFLLKNGLSLDMAVGDFDSITEDELLYIKHY
CSNIVSASVEKNDTDTELALKTIFKEFPEAQVTVFGAFGGRIDHMMSNIFLPSDTDLEPF
MSQIRLKDEQNIVTYLPSGKNQVSRIEGMSYVSFMPESESTLQISGAKYELNKSNYFKKK
MYSSNEFMTSPIEVELKDGYLIIIYSKDRG
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaattgctttatttgctggcggtgacttaacttattttgaatatgattttgac
tattttgtcggaattgaccgtggaagcctatttttattaaaaaatgggctttctttggac
atggcagtgggtgattttgattctataacagaagatgaactgctttatatcaaacactat
tgtagcaatatcgtttctgctagtgtagaaaaaaatgatacagatacagaattagcttta
aaaactattttcaaagaatttccagaagctcaagtgaccgtatttggagcatttggtggc
aggattgaccatatgatgtctaatatctttttaccaagtgacacagatttagaaccattt
atgtcacaaatcagactcaaagatgaacaaaacatagtgacttatctaccatccgggaaa
aatcaagtctcaaggattgaagggatgtcctatgtctcgttcatgcctgagagtgagtct
actttgcagatttctggggctaaatatgaattgaacaaaagtaattattttaagaaaaaa
atgtattccagtaatgaatttatgacttcgccaattgaagtagagctcaaagatggttac
ttaatcattatttatagtaaggatagaggttaa

DBGET integrated database retrieval system