KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1799Help
Entry
SAK_1799          CDS       T00278                                 

Definition
(GenBank) ribosome-associated GTPase, putative
  KO
K06949  ribosome biogenesis GTPase / thiamine phosphate phosphatase [EC:3.6.1.- 3.1.3.100]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00730  Thiamine metabolism
sak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SAK_1799
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sak03009]
    SAK_1799
Enzymes [BR:sak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.100  thiamine phosphate phosphatase
     SAK_1799
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     SAK_1799
Ribosome biogenesis [BR:sak03009]
 Prokaryotic Type
  GTPases
   SAK_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RsgA_GTPase RsgA_N MMR_HSR1 ABC_tran AAA_22 AAA_23 AAA_29 NACHT AIG1 RNA_helicase AAA AAA_16 FeoB_N AAA_25 SRP54 NB-ARC NTPase_1
Motif
Other DBs
NCBI-ProteinID: ABA44815
Position
complement(1791468..1792298)
Genome map
AA seq 276 aa AA seqDB search
MESDGVVYQTRARGNFRKKGQIPYVGDWVEFSSQDQSEGYILSIEERKNSLVRPPIVNID
QAVVIMSAKEPDFNANLLDRFLVLLEYKMIQPIIYISKLDLLDDLVVIDDIREHYQNIGY
VFCYSQEELLPLLADKVTVFMGQTGVGKSTLLNKIAPELKLETGEISDSLGRGRHTTRAV
SFYNVHKGKIADTPGFSSLDYEVDNAEDLNESFPELRRLSHFCKFRSCTHTHEPKCAVKE
ALTQGQLWQVRYDNYLQFLSEIENRRETYKKVIKRK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtggaatctgacggtgttgtttatcagacacgtgcgcgtggaaattttagaaaaaaaggt
caaattccctacgttggggattgggttgaattttcttcgcaagatcaatcagaaggatat
attctatcaattgaagagcgtaaaaatagcctcgtacgaccacctattgttaatattgat
caagctgtcgttatcatgtctgctaaagaacctgattttaacgctaacttattagaccgg
ttcttagtacttctagaatataagatgattcagcctatcatttatatttccaagttggat
ttgttagacgatttggttgttattgatgatattcgcgaacattatcagaatataggctat
gttttctgttattctcaagaggaactcttgcctctgttagcagataaagtgactgttttt
atggggcagacaggtgtcggaaaatcaacgcttctcaacaaaattgctcctgagttgaaa
cttgaaactggtgaaatttcggatagtttaggccgtggccgacacaccacaagagcagtt
agtttctataatgttcataaaggaaaaattgcagacactcctggtttttcttctttggat
tatgaagtggacaatgcagaggacttaaacgaatcctttccagagcttcgtagacttagt
catttttgtaaattccgctcgtgtacgcatacacatgagcctaaatgtgctgtaaaagaa
gccttgactcaaggtcagttatggcaagtccgctatgataactacctccaatttttaagt
gaaattgagaaccgccgtgaaacatataagaaagttattaaaagaaagtag

DBGET integrated database retrieval system