KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1805Help
Entry
SAK_1805          CDS       T00278                                 

Definition
(GenBank) hypothetical protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sec3_C_2
Motif
Other DBs
NCBI-ProteinID: ABA46274
Position
complement(1796221..1796493)
Genome map
AA seq 90 aa AA seqDB search
MWDVLTGKESVRTLKKQLDKELIHSVYAPRKRSKFHDIITSHHKEIDEVAINTKTAIHKV
ANQLDEAIKGEFRSRVEEAIESNQQKYNHL
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atgtgggatgtcctgactggtaaggagtcagtaaggactttaaaaaaacaattggataaa
gaattgatacatagcgtgtacgcgccacgcaagagatctaagtttcacgatattattacg
tcgcatcataaagaaatagacgaagtagccatcaacacaaagacagctattcataaagtt
gctaatcaattggacgaggcaataaaaggagaatttcgttcaagggttgaggaggctatt
gaaagcaatcagcaaaaatataatcatttatag

DBGET integrated database retrieval system