KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1806Help
Entry
SAK_1806          CDS       T00278                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF773
Motif
Other DBs
NCBI-ProteinID: ABA45111
Position
complement(1796512..1796904)
Genome map
AA seq 130 aa AA seqDB search
MALIDIIEKQLADTQRKISDLDDAYHHSCCQFEEKLDDLSVRKNKITNMLQETYDAVEYD
LRYSNDSSDMMTLNRILDSYHDDLEQAYHKEYYALSAQEEEYRANYIRQRSEHELTFEEL
QREKKRELMK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atggcactgattgatatcattgaaaaacaattagctgatactcagagaaaaatatcagat
ttagacgatgcctatcaccatagttgttgccagtttgaagaaaaattagacgatctctca
gtaagaaaaaataagattactaatatgcttcaagaaacttacgacgctgttgaatatgat
ttgagatatagtaatgatagctcagatatgatgacgctcaatcgtattttagattcttat
catgacgacttagagcaagcttaccataaagagtactatgccttgtccgctcaagaagaa
gaatatagagctaactatattcggcaacgttcagaacatgaactaacctttgaagagttg
caaagggaaaagaaaagagaattaatgaagtag

DBGET integrated database retrieval system