KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1809Help
Entry
SAK_1809          CDS       T00278                                 

Gene name
dltD
Definition
(GenBank) dltD protein
  KO
K03740  D-alanine transfer protein
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak01503  Cationic antimicrobial peptide (CAMP) resistance
sak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sak00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SAK_1809 (dltD)
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SAK_1809 (dltD)
Antimicrobial resistance genes [BR:sak01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SAK_1809 (dltD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DltD Mtr2
Motif
Other DBs
NCBI-ProteinID: ABA44710
Position
complement(1798754..1800016)
Genome map
AA seq 420 aa AA seqDB search
MLKRLGKVFGPLVCALLLLVGLYLVFPVSQPHHLGKEKNSAVALTKAGFKSRVQKVRAFS
DPKANFVPFFGSSEWLRFDAMHPSVLAEAYNRPYIPYLLGQKGAASLTQYYGIQQIKGQI
KNKKAIYVISPQWFVRKGANKGAFQNYFSNDQTIRFLQNQTGTTYDRYAARRLLKLYPEA
SMSDLIEKVADGQKLSNKDKQRLKFNDWVFEKTDAIFSYLPLGKTYNQAIMPHVGKLPKA
FSYNHLSRIASQDAKVATRSNQFGIDDRFYQTRIKKHLKKLKGSQRHFNYTKSPEFNDLQ
LVLNEFSKQNTDVLFVIPPVNKKWTDYTGLDQKMYQKSVEKIKHQLQSQGFNHIADLSRD
GGKPYFMQDTIHLGWNGWLELDKHINPFLTEENSKPNYHINNKFLKKSWAKYTGRPSDYK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaacgtctaggtaaagtatttggacctctagtttgtgctttactattgttggta
ggattatatcttgtttttcctgtttctcagcctcatcatttaggtaaggaaaaaaacagt
gcagtagcgttgacgaaggcaggttttaaaagcagagttcaaaaagttagagctttcagt
gatcctaaagccaattttgtccctttctttggttcaagtgagtggctaagatttgatgca
atgcatccatcagttttagcagaggcttacaatagaccttatatcccatatcttttaggt
caaaaaggggcggcttctctgacacaatactatggcattcaacagattaaaggacaaatc
aaaaataaaaaagctatctatgttatttctccgcaatggtttgttcgcaagggagccaac
aaaggtgcttttcaaaactatttcagcaacgatcaaaccattcgatttttgcaaaatcaa
acagggacaacctacgataggtatgctgctcgtcgattgttaaaattatatcctgaagct
tctatgtcagatttgatagaaaaagttgcagatggccaaaaactatcaaataaagacaaa
caaagactaaagtttaatgattgggtatttgagaagacagatgctatttttagctatcta
ccactaggaaaaacttataatcaggcaataatgcctcatgttggtaaattaccgaaagca
ttctcatataatcatttatcgcgtattgcatcacaagatgctaaagtagcaacgagatca
aatcaatttggtattgatgatcgcttttaccaaacaagaattaaaaagcacttaaaaaaa
ttgaaagggtcacaacgacatttcaattatactaagtcaccagaatttaatgatttacag
ttggttcttaatgaattctcaaaacaaaatacagatgtcctttttgtcataccaccagta
aataaaaagtggacagactacacagggcttgatcaaaaaatgtatcaaaaatctgtagaa
aaaataaaacaccaacttcaaagtcaaggtttcaatcatatcgctgacctttctcgagat
ggaggtaagccatactttatgcaagatacaatccatttaggttggaatggttggttagag
ctagataagcatatcaatccatttttaacagaggaaaacagcaagccgaattatcacatt
aataataaatttttgaagaaatcttgggcaaaatatacaggacgtccaagtgattacaag
taa

DBGET integrated database retrieval system