KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1811Help
Entry
SAK_1811          CDS       T00278                                 

Gene name
dltB
Definition
(GenBank) dltB protein
  KO
K03739  membrane protein involved in D-alanine export
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak01503  Cationic antimicrobial peptide (CAMP) resistance
sak02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sak00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAK_1811 (dltB)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    SAK_1811 (dltB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sak01504]
    SAK_1811 (dltB)
Antimicrobial resistance genes [BR:sak01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    SAK_1811 (dltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MBOAT MBOAT_2
Motif
Other DBs
NCBI-ProteinID: ABA45330
Position
complement(1800263..1801528)
Genome map
AA seq 421 aa AA seqDB search
MIQAFLEKLPHLDVYGNPQYFFYLILAVLPIYIGLFFKKRFALYEIIFSLSFIVMMLTGS
TFNQLKSLLAYVVGQSLLVFIYKAYRKRFNHTLVFYVTVCLSIFPLFLVKLIPAISEDGH
QSLFGFLGISYLTFRAVAMIIEMRDGVLKEFTLWEFLRFLLFFPTFSSGPIDRFKRFNED
YINIPDRNELLDMLGQAIHYLMLGFLYKFILAYIFGSLIMPPLKELALEQGGVFNWPTLG
VMYAFGFDLFFDFAGYTMFALAISNLMGIKSPINFDKPFKSRDLKEFWNRWHMSLSFWFR
DFVFMRLVKLLVKNKVFKNRNVTSSVAYIINMLLMGFWHGLTWYYIAYGLFHGIGLVIND
AWVRKKKNINKERRLAKKPLLPENKWTYALGVFITFNVVMFSFLIFSGFLDLLWFPQPHN
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgatacaggcatttttagaaaaacttcctcacttggatgtttatgggaatccacaatat
ttcttctaccttatcttagctgttctaccaatttacatcggcttattctttaagaagcgt
tttgccttatatgagattatttttagtctaagttttattgtaatgatgttgactggtagt
acttttaatcaattgaagtcactattggcatacgttgtcggacaatctctgctagttttt
atctataaagcttaccggaaacgatttaatcatactttggtcttttatgtaacggtttgt
ttatctatttttccgctatttttggtaaaattaattccagctatatctgaggatgggcat
cagtcactttttgggtttctaggaatttcttaccttacttttagagctgttgctatgatt
attgaaatgagagacggtgttttgaaagaatttactttatgggaattcttaagattttta
ctcttctttccaactttctcaagtggaccaattgatcgttttaaacgattcaatgaggat
tacattaatatcccagatcgaaacgaactcctagatatgttaggtcaagcgattcattat
ttgatgttaggttttctctataagtttattttagcctatatttttggaagtctgattatg
cctcctctaaaagaattagcgctagaacagggtggtgtgtttaattggccaacacttggg
gttatgtatgcctttggttttgatttgttctttgattttgcaggttacacaatgtttgcg
ttggctatttctaacctaatggggattaagtctccgattaactttgacaaacctttcaaa
tcacgcgacctaaaagaattttggaatagatggcatatgagcctttctttctggtttaga
gactttgttttcatgaggcttgttaagcttttagttaaaaataaagtttttaaaaaccgt
aatgttacttcaagtgtagcttatattatcaatatgcttcttatgggattctggcatggg
ttaacttggtactatatagcctatggtctctttcatgggattggcctagttattaatgac
gcttgggtacgtaagaagaaaaatattaataaagaaagaagattggctaaaaaaccactt
ttaccagaaaacaaatggacttatgctttgggtgtcttcatcacctttaatgtagttatg
ttttctttcttgattttttcaggatttttagatcttttgtggttcccacaaccgcataac
aaataa

DBGET integrated database retrieval system