KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1815Help
Entry
SAK_1815          CDS       T00278                                 

Gene name
rpmH
Definition
(GenBank) ribosomal protein L34
  KO
K02914  large subunit ribosomal protein L34
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak03010  Ribosome
Module
sak_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sak00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    SAK_1815 (rpmH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sak03011]
    SAK_1815 (rpmH)
Ribosome [BR:sak03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    SAK_1815 (rpmH)
  Bacteria
    SAK_1815 (rpmH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L34
Motif
Other DBs
NCBI-ProteinID: ABA46169
UniProt: Q3JZ91
Position
complement(1805423..1805557)
Genome map
AA seq 44 aa AA seqDB search
MKRTYQPSKIRRQRKHGFRHRMSTKNGRRVLASRRRKGRKVLSA
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtacttatcaaccaagtaaaatccgtcgccaacgtaaacacggattccgtcac
cgtatgtcaactaaaaacggacgtcgcgtgcttgctagccgccgtcgtaaaggacgtaaa
gtgttatcagcttaa

DBGET integrated database retrieval system