KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1834Help
Entry
SAK_1834          CDS       T00278                                 

Definition
(GenBank) PTS system, IIB component, lactose/cellobiose family
  KO
K02822  PTS system, ascorbate-specific IIB component [EC:2.7.1.194]
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00053  Ascorbate and aldarate metabolism
sak01100  Metabolic pathways
sak01120  Microbial metabolism in diverse environments
sak02060  Phosphotransferase system (PTS)
Module
sak_M00283  PTS system, ascorbate-specific II component
sak_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:sak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SAK_1834
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SAK_1834
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sak02000]
    SAK_1834
Enzymes [BR:sak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.194  protein-Npi-phosphohistidine---L-ascorbate phosphotransferase
     SAK_1834
Transporters [BR:sak02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    SAK_1834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB
Motif
Other DBs
NCBI-ProteinID: ABA44686
Position
complement(1828181..1828459)
Genome map
AA seq 92 aa AA seqDB search
MVKVLTACGNGMGSSMVIKMKVENALRQLGVSNFESASCSVGEAKGLAANYDIVVASNHL
IHELDGRTKGHLVGLDNLMDDNEIKTKLQEIL
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagttcttacagcatgcggaaacggcatgggatcatcaatggttatcaaaatg
aaagttgaaaatgcgcttcgtcaattaggcgttagcaactttgagtcagcatcttgctca
gtcggagaagcaaaaggtttagctgcgaactacgatatcgtggttgcttcaaaccacctt
atccatgaattagacggacgtacaaaaggtcatttagtaggtcttgataaccttatggat
gacaatgaaataaaaacaaaactacaagaaattttgtaa

DBGET integrated database retrieval system