KEGG   Streptococcus agalactiae A909 (serotype Ia): SAK_1835Help
Entry
SAK_1835          CDS       T00278                                 

Definition
(GenBank) PTS system, sugar-specific IIC component, putative
  KO
K03475  PTS system, ascorbate-specific IIC component
Organism
sak  Streptococcus agalactiae A909 (serotype Ia)
Pathway
sak00053  Ascorbate and aldarate metabolism
sak01100  Metabolic pathways
sak01120  Microbial metabolism in diverse environments
sak02060  Phosphotransferase system (PTS)
Module
sak_M00283  PTS system, ascorbate-specific II component
sak_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:sak00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SAK_1835
 Environmental Information Processing
  Membrane transport
   02060 Phosphotransferase system (PTS)
    SAK_1835
Transporters [BR:sak02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Ascorbate-specific II component [MD:M00283]
    SAK_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EIIC-GAT
Motif
Other DBs
NCBI-ProteinID: ABA45166
Position
complement(1828487..1829926)
Genome map
AA seq 479 aa AA seqDB search
MENFLAPLNWFSQNILQNPAFFVGLLVLIGYLLLKKPLHDVFAGFIKATVGYLILNVGAG
GLVNTFRPILVALAKKFNLEAAVIDPYFGLASANAKLETMGFISVATTALLIGFGINILL
VALRKVTKVRTLFITGHIMVQQAATISVFVLLLIPQLRNGFGAWAVGIICGLYWAVSSNM
TVEATQRLTGGGGFAIGHQQQFAIWFVDKVAPFFGKKEENLDNLKLPTFLNIFHDTVVAS
ATLMLVFFGGILAVLGPDIMSNVKLIGPGAFVPTKQAFFMYILQTSLTFSVYLFILMQGV
RMFVTELTNAFQGISNKLLPGSFPAVDVAASYGFGSSNAVLSGFAFGLIGQLITIALLVV
FKNPILIITGFVPVFFDNAAIAVYADKRGGWKAAVALSFISGIIQVALGAVAVGLLGLAG
GYHGNIDFEFPWLAFGYIFKYLGIAGYVIVCLFFLAIPQLQFMKSKDKEAYYRGDAPAE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacttcctagctccccttaattggttctcgcaaaatatcttgcagaatccagcc
ttcttcgtaggtctattggtactcattgggtatcttttattgaagaaaccacttcatgat
gtctttgctggttttatcaaagcgaccgttggatatttgattttgaacgtaggtgcagga
ggattggttaatacattccgtccaatcttagttgctcttgctaaaaaatttaatttagaa
gctgctgttattgacccttactttggtttagcatcagcaaatgctaagttagaaacaatg
ggctttatcagtgttgcaacaacagcactcttgattggttttgggattaacattctcttg
gttgctcttcgtaaagtaactaaagtccgtactctttttattactggtcatatcatggta
caacaagctgcaacaatttcagtatttgtactgctcttgattccacaacttcgtaatggt
tttggtgcatgggctgttggtatcatttgtggtctatattgggcggtaagttctaatatg
accgttgaagcaactcaacgccttacaggtggtggtggatttgccattggacaccaacaa
caatttgcaatttggtttgttgataaggttgcgccattcttcggtaaaaaagaagaaaac
cttgataacttaaaattaccaacattcttaaatattttccatgatacagttgttgcatca
gcaacattgatgctagttttctttggaggaatcttagctgtccttggtccagacattatg
tctaatgttaaattaattggacctggggcatttgtaccaactaagcaagctttcttcatg
tacatccttcaaacatcattgacattctcagtttaccttttcattttgatgcaaggtgta
cgcatgttcgttacagaattgacaaatgccttccaaggcatctcaaacaaacttcttcca
ggatcattcccagcggttgacgttgcagcttcatatggttttggttcttcaaatgcagtt
ctttcaggatttgcttttggtttgattggtcaattaattacaatcgctctacttgttgtc
ttcaaaaatccaatcttgattatcacaggattcgttccagtattctttgataatgcggca
atcgctgtttatgcagataaacgtggtggctggaaagcagcagtagctctatcatttatc
tcaggtattattcaggtggcacttggtgctgttgctgtaggtcttttaggacttgcaggt
ggttatcatggaaatattgactttgaattcccatggttagcatttggttacatcttcaag
tatttaggtatcgctggttacgtgattgtatgtctcttcttcttagctattccacaactt
caatttatgaaatctaaagataaagaagcatactatcgtggtgatgcgcctgcagaataa

DBGET integrated database retrieval system