KEGG   Sphingopyxis alaskensis: Sala_1244Help
Entry
Sala_1244         CDS       T00361                                 

Definition
(GenBank) Acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00071  Fatty acid degradation
sal00072  Synthesis and degradation of ketone bodies
sal00280  Valine, leucine and isoleucine degradation
sal00310  Lysine degradation
sal00362  Benzoate degradation
sal00380  Tryptophan metabolism
sal00620  Pyruvate metabolism
sal00630  Glyoxylate and dicarboxylate metabolism
sal00640  Propanoate metabolism
sal00650  Butanoate metabolism
sal00900  Terpenoid backbone biosynthesis
sal01100  Metabolic pathways
sal01110  Biosynthesis of secondary metabolites
sal01120  Microbial metabolism in diverse environments
sal01130  Biosynthesis of antibiotics
sal01200  Carbon metabolism
sal01212  Fatty acid metabolism
sal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sala_1244
   00630 Glyoxylate and dicarboxylate metabolism
    Sala_1244
   00640 Propanoate metabolism
    Sala_1244
   00650 Butanoate metabolism
    Sala_1244
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Sala_1244
   00072 Synthesis and degradation of ketone bodies
    Sala_1244
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sala_1244
   00310 Lysine degradation
    Sala_1244
   00380 Tryptophan metabolism
    Sala_1244
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sala_1244
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sala_1244
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sala_1244
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sal04147]
    Sala_1244
Enzymes [BR:sal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Sala_1244
Exosome [BR:sal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sala_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABF52959
UniProt: Q1GTR3
Position
complement(1294604..1295851)
Genome map
AA seq 415 aa AA seqDB search
MAEAYIIDAVRTPRGIGKPGKGALSHLHPQHLAATVLKAIRDRNNLDTATVDDIIWSTSS
QNGKQGGDLGRMAALSAGYDIKASGTTLDRFCGGGITSVNLAAATVMSGMEDCVVAGGTE
MMSYTSAFAAEQANAGLPPRLMGSGHEALDELHPQSHQGVCGDAIATIEGIGREALDALA
LVSQRRADRAIKEGRFAKSLVPVLNPDGSIALDHEEFPRPETSAEGLAALKPSFAALADF
DMGGFTFRQQINRRYPDLEIQHFHHAGNSSGVVDGAAALLVTSKAYADKHGLKPRARIVA
YANIGDDPTLMLNAPVPAAKKVLDKAGLTRDDIDVWEINEAFAVVAEKFIRDLDLPRDKV
NINGGAMALGHPIGATGSILIGTALDELERSGGRYGLVTMCAAGGMAPAIIIERL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagcctatatcatcgacgccgtccgcaccccgcgcgggattggcaagcccggc
aagggcgcgttgtcgcatctccacccgcagcatctcgccgcaacggtgctgaaggcgatc
agggatcgcaataatctcgacaccgcgacggtcgacgacatcatctggtcgacgtcgagc
cagaatggcaagcagggcggcgacctcggccgcatggcggcgctgtcggcgggttatgac
atcaaggcatcgggaacgacgctcgaccgcttctgcggcggcggcatcacctcggtcaat
ctcgccgcggcgacggtgatgagcggcatggaggattgcgtcgtcgcgggcggcaccgag
atgatgagctacaccagcgcctttgccgccgaacaggcgaacgccggcctgccgccgcgc
ctgatggggtcgggccatgaggcgctcgacgagcttcacccgcagtcgcatcagggcgtg
tgcggcgacgccatcgcaacgatcgaagggatcggccgcgaggcgctcgatgcgctcgca
ctcgtcagccagcggcgcgccgaccgtgcgatcaaggaaggtcgcttcgccaaatcgctg
gtgcccgtgctcaaccccgacggcagcatcgcactcgaccatgaggagtttccgcgcccc
gaaaccagcgccgaaggtctcgccgcgctcaagccgagttttgccgcgctcgccgatttc
gacatgggcggcttcaccttccgccagcagatcaatcgtcgctatcccgatctcgaaatc
cagcattttcaccatgccggcaattcatcgggggtcgtcgatggcgctgcggcgctgctc
gtcacctcgaaggcctatgccgacaaacacggcctgaaaccccgcgcgcgcatcgtcgcc
tacgccaatatcggcgacgatccgaccttgatgctcaacgccccggtccccgcggcgaag
aaggtgctcgataaggcggggctgaccagggacgacatcgacgtctgggaaatcaacgag
gctttcgccgtcgttgcggagaagttcatccgcgacctcgacctgccccgcgacaaggtc
aacatcaacggcggcgcgatggcgctcggccacccgatcggcgccaccggatcgatcctg
atcggcaccgcgctcgacgagctggaacgctcgggcggtcgttacggcctcgtcaccatg
tgcgccgccggcggcatggcgcccgcgatcatcatcgagcggctgtga

DBGET integrated database retrieval system