KEGG   Sphingopyxis alaskensis: Sala_1954Help
Entry
Sala_1954         CDS       T00361                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal00900  Terpenoid backbone biosynthesis
sal01100  Metabolic pathways
sal01110  Biosynthesis of secondary metabolites
sal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sal00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Sala_1954
Enzymes [BR:sal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Sala_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom NAD_binding_3 B12-binding
Motif
Other DBs
NCBI-ProteinID: ABF53666
UniProt: Q1GRQ6
Position
complement(2061228..2062391)
Genome map
AA seq 387 aa AA seqDB search
MTRRLSLFGATGSVGQSTLDLVRRDREAWRVGVLTANCDVQELARLAIEFRPDVAVVADE
SCYGYLKAALAGQGIECAAGAAALVEAAERRADLVMAAIVGTAGLAPTMTALAAGHDVAL
ANKEALVSAGELMTAAARASGATILPVDSEHNAIFQCLAGGRIDQVRRIILTASGGPFRT
MSAADMAAVTPAQAVAHPNWSMGAKISVDSATMMNKGLELIEAHHLFPVGLDRIEILVHP
QSVIHSLVEYIDCSTLAQLGSPDMRIPIASALAWPQRMATPCAPLDLAAISRLDFEAPDE
ERFPATALCRAAIAAGGARPAQLNAANEVAVAAFLAGRISFPAIVDTVRRVVDAAEPAAP
SSLQDIFSVDTASRAAALRFVEQYEHA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgccgtctctccctcttcggcgccacgggatcggtcgggcaatcgacgctcgac
cttgtccgccgcgaccgcgaggcgtggcgcgtcggggtgctgacggccaattgcgacgtc
caggaactggcgcggctcgccatcgagttccggcccgatgtcgcggtggtcgccgatgaa
agctgttatggctatctcaaggccgcgctcgcggggcaggggatcgaatgtgcggcgggc
gcggcggcgctcgtcgaagccgccgaacggcgggccgatctcgtcatggccgcgatcgtc
ggcaccgcggggctggcgccgacgatgacggcactggcggcggggcacgacgttgcgctc
gccaacaaggaagcgctggtgtcggccggcgagctgatgaccgccgcagcgcgcgcgtcg
ggcgcgacgatcctcccggtcgacagcgaacataatgcgatctttcaatgcctcgcgggc
gggcggatcgaccaggtgcggcgcatcatcctgaccgcgagcggcggcccgttccgcacc
atgagcgccgccgacatggccgcggtgaccccggcgcaggcggtcgcgcatcccaattgg
tcgatgggcgccaagatcagcgtcgattcggcaacgatgatgaacaagggcctcgaactc
atcgaggcgcatcatcttttccctgtcgggctcgaccggatcgagatcctcgtccacccg
caatcggtgatccacagcctcgtcgaatatatcgactgctcgacgctcgcacagctcggt
tcgcccgacatgcgcatcccgatcgcgtcggcgctcgcctggccgcagcggatggcgacg
ccgtgcgcgccgctcgacctggcggcgatttcgcggctcgatttcgaggcgcccgacgaa
gagcgcttccccgcgaccgcgctctgccgcgccgcgatcgcggcgggcggcgcgcgcccg
gcgcagctcaatgccgcgaacgaggtggcggtcgccgccttcctcgcgggccgcatttcc
ttccccgcgatcgtcgatacggtacggcgggtggtcgacgcggcggaacctgcggctccg
tcctcgcttcaggacatattcagcgtcgataccgcatcgcgggcggctgcgctgcgcttt
gtggaacaatatgaacatgcttga

DBGET integrated database retrieval system