KEGG   Sphingopyxis alaskensis: Sala_2483
Entry
Sala_2483         CDS       T00361                                 
Name
(GenBank) putative conjugal transfer protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
sal  Sphingopyxis alaskensis
Pathway
sal02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sal00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Sala_2483
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sal02044]
    Sala_2483
Enzymes [BR:sal01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Sala_2483
Secretion system [BR:sal02044]
 Type IV secretion system
  Trb secretion system protein
   Sala_2483
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_22 TraG-D_C ABC_tran AAA_16 HerA_C DUF87 FtsK_SpoIIIE AAA_29 AAA_7
Other DBs
NCBI-ProteinID: ABF54190
UniProt: Q1GQ82
Position
complement(2620969..2623413)
AA seq 814 aa
MMNLSEYRTKSARLADFLPWVCLVAEGVVLNKDGSFQRTARFRGPDLDSATPAELVAVTS
RLNNTLRRLGSGWAVFVEAQRVPAMTYPVSEFPDPVSELVDIERREQFREEGAHFESFYY
LTLLWMPPAEEAARAEAWLYEGRSKTGVDAQELLKSFADRTERVLHLVEGFMPEVEWLGD
GETLTYLHSCISTKAQRVRVPETPAYLDALLADEALVGGLEPRLGDHHLRTLTITGFPSV
TFPGLLDELNRQAFGYRWSSRAIMLDKTDATKLLTKIRRQWFAKRKSVAAILKEVMTNEA
SVLMDSDASNKAADADMALQELGADEAGIAYVTATITVWDRDPALAAEKLRLVEKIVQSR
DFTCTVEGVNALEAWFGSLPGHVYANVRQPPVSTLNLAHLIPLSAVWAGAERDEHFGQSP
LLYGKTEGSTPFRLSLHVGDVGHCLVVGPTGAGKSVLLALMAMQFRRYEGSQIFAFDYGG
SIRAAALGMGGDWQDLGGALHDAGSDGSVALQPLARIDEPAERAWAAEWLAALLTGEGVA
VDPAAKEHLWSALTSLATAPVTERTLTGLAVLLQSQELKLALSPYLVGGPWGRLLDAEVE
HLGSARVQALETEGLVGASSAATVLSYLFHRIERRLDGSPTLIIIDEGWLVLDSPAFAAQ
LREWLKTLRKKNASVIFATQSLADIEGSSIAPAIIESCPTRIFLPNERAAEPQIARVYDR
FGLNSRQVEILSRATPKRDYYCQSRRGNRLFDLGLGDIALAFAAASSKSDQIRIGELMAA
HGQDQFAAAWLRHRGLEWAADLLGNLEIAAPLKE
NT seq 2445 nt   +upstreamnt  +downstreamnt
atgatgaatctctccgaatatcgcacgaaatccgcccgcctcgctgactttctcccttgg
gtctgcctggtggcggagggcgtggtgctgaacaaggatggctccttccagcgcacggcg
cgcttccgcgggcccgacctcgacagcgccacgcccgccgaacttgtcgcggtcacgtcg
cggctcaacaacacgctgcgccggctgggatcaggctgggccgtgttcgtcgaggcgcag
cgggtcccggccatgacctatcccgtgtccgagttccccgacccggtatcggaactcgtc
gatatcgaacgccgcgagcagttccgcgaggagggggcgcatttcgagagcttctattat
ctgaccttgctctggatgccgcccgccgaggaggcggcgcgcgccgaggcctggctctac
gagggccgttcgaagacgggcgtcgatgcgcaggaattgctgaaaagcttcgccgatcgc
accgagcgcgtgctgcatcttgtcgagggcttcatgcctgaggtcgaatggctcggtgac
ggcgagacgctgacctatctgcacagctgcatctcgaccaaggcccagcgcgtccgcgtg
cccgaaacgccggcctatctcgacgcgctgctcgccgacgaggcgctggtcggcggtctc
gagccgcggctcggcgaccatcatctgcgcacgctcaccataaccggctttccgagcgta
accttcccggggctgctcgacgaactcaaccgccaggccttcggctatcgctggtcgtcg
cgcgcgatcatgctcgacaaaaccgacgcgaccaagctgctgaccaagattcgccggcaa
tggttcgccaagcgcaagtccgtcgccgcaatcctcaaggaagtgatgaccaacgaggcg
tcggtcctgatggacagcgatgcctcgaacaaggcggccgacgccgacatggcgttgcag
gagctgggcgccgacgaagcgggtatcgcctatgtcacagcgacgatcacggtttgggac
cgcgatccggccttggcggccgagaagctgcggctggtcgagaagatcgtccagagccgc
gacttcacctgcaccgtcgagggcgtgaacgcgctcgaagcctggttcgggagcctgccg
ggccatgtctatgccaatgtccgtcagcccccggtctcgacgctcaatctcgcccatctg
atcccgctgtcggcggtgtgggcgggggcggaacgggacgagcatttcggtcagtccccc
ttgctttacggcaagaccgaaggttcgaccccgttccgcctttcgctgcatgtcggcgat
gtcggtcactgcctcgtcgtcggtccgaccggcgccggcaagtcggtgcttctggcgctg
atggcgatgcagttccgccgctatgaaggcagccagatcttcgccttcgattatggcgga
tcgatccgcgccgcggcgcttggcatgggcggcgactggcaggatctcggcggcgcgctt
cacgacgcggggagcgacgggtcggtggcgctccagccgctcgcgcggatcgacgaaccg
gccgagcgcgcatgggccgccgaatggcttgcggcgctgctcacgggcgaaggcgttgcg
gtcgatccggcggcgaaggagcatctctggtcggcattgacttcgctcgcgaccgcgccg
gttaccgagcgaacgctcactggactcgccgtcttgctccagtcgcaggaactgaagctc
gccctttcgccatatctcgttggcggcccatggggtcgcctgctcgatgccgaggtcgag
catctgggctccgcgcgggtgcaggcgcttgaaaccgaaggcttggtcggcgcttcgtcg
gcggcgacggtcctctcctatctgttccaccgcatcgagagacgcctcgacggctcgccg
acgttgatcatcatcgacgaaggctggctcgttctcgacagccccgccttcgccgcgcaa
ctgcgcgaatggctcaagacgctccgcaagaagaatgcgagcgtgatcttcgcgacgcag
agcctcgccgatatcgaagggtcgagcatcgcgcccgcgatcatcgaaagctgcccgaca
cggatattcctgccgaacgagcgcgccgctgagccgcagatcgcgcgggtctatgaccgc
ttcggcctgaacagcagacaggtggagatattgagccgggcgacgccgaagcgtgactat
tattgccagtcacggcgcggcaaccgactgttcgaccttggcctcggcgacatcgcgctc
gcctttgccgccgcctcttcgaaatccgaccagattcgcatcggcgagctgatggccgcg
catggccaagaccagttcgcggcggcctggcttcgccatcgcggcctcgaatgggccgcc
gatctgctcggcaatcttgaaatcgcagcccccctgaaggagtga

DBGET integrated database retrieval system