KEGG   Salinibacterium sp. UTAS2018: ESZ53_00855Help
Entry
ESZ53_00855       CDS       T05816                                 

Definition
(GenBank) hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
sala  Salinibacterium sp. UTAS2018
Pathway
sala00010  Glycolysis / Gluconeogenesis
sala01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESZ53_00855
Enzymes [BR:sala01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ESZ53_00855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like HAD_2 Hydrolase CW_binding_2
Motif
Other DBs
NCBI-ProteinID: QAV69115
UniProt: A0A410YF68
Position
175690..176304
Genome map
AA seq 204 aa AA seqDB search
MTLLFIFDMDDVLYGYDWRARMAAMSDLTGLSFLELRRSWWHDDGEFGAEAGLYPTGEEY
LAAFEEAIGQRVDLASWLAIRAAAMTPWPDSLAAARRAADLGQATLLTNNGALLGDHLST
VAPDLVEIFGDHLHTSSHYGARKPNPVVFERALEAYGVAPENAFFADDMPENVAAAESLG
ITGHEFLTGAAMHAAIEEFAAARS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcttttcatctttgacatggatgatgtgctctacggctacgactggcgtgca
cggatggccgccatgagcgacctcaccggcctcagttttctcgagctccgccgtagctgg
tggcacgatgatggcgagttcggcgccgaagcggggctttaccccaccggcgaggaatac
cttgccgccttcgaggaagccatcgggcagcgagtagatctcgccagctggctagcgatc
agggcggccgcgatgacgccgtggcccgactcactcgccgcggcccgacgcgccgcggac
ctcggtcaggcaaccctgctgacgaataacggtgcgcttctcggcgaccatctctcgacc
gttgcacccgatctcgtcgagatctttggtgatcacctgcacacctcaagccattacggc
gcccgcaagccgaatcccgttgtgttcgaacgtgccctcgaggcgtacggcgttgcgccc
gagaacgcgttttttgcggatgacatgcccgagaacgttgccgctgccgaaagcctcggc
atcaccggccacgaatttcttacgggagcggctatgcacgcagcgatcgaggagtttgcg
gccgcgcgctcgtag

DBGET integrated database retrieval system