KEGG   Salinibacterium sp. UTAS2018: ESZ53_02185Help
Entry
ESZ53_02185       CDS       T05816                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sala  Salinibacterium sp. UTAS2018
Pathway
sala00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sala00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ESZ53_02185
Enzymes [BR:sala01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ESZ53_02185
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ESZ53_02185
    1.1.1.-  
     ESZ53_02185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: QAV69352
UniProt: A0A410YG35
Position
complement(459856..460929)
Genome map
AA seq 357 aa AA seqDB search
MKAARFHGRKDIRIDDIPEPELRPGAVAIDVAWCGICGTDLHEYLEGPIFIPAAGHPHPL
THEEVPVTMGHEFSGTITALGEGVTDLTVGENVVVEPYFVCGECAPCRAGNYNLCTKMGF
IGLAGGGGGLSEKIVVERRWVHPIGDIPLDQAALIEPLAVGHHAFVRSGAKAGDTAFIGG
GGPIGLLLAAVLSAEGITVIMSEPGTARREMALSTGVADHVIDPSVEDAVAKVMELTNGV
GADVAFECSSINAVLDQLFDAVKPTGVIVNVSIWGHPAQLDMQKLVLKEIDLRGTIAYAH
DHPATIKLVQDGKVNLEPFITGRIHLDKLIDEGFMTLIDHKETAVKIIVRPEVSNVS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgtttccacggacgcaaagacatccgcatcgatgacattccggaacca
gagcttcgccccggcgcagtcgctatcgatgtcgcatggtgcggcatctgcggcaccgac
cttcacgagtatctcgaaggcccaatcttcatcccggcggctgggcatccgcacccgctg
actcacgaagaagttcccgtgaccatgggccacgaattctcaggaacaatcacggctctt
ggcgaaggagtcaccgatctcacagtcggagagaacgttgtcgttgaaccgtactttgtg
tgcggcgagtgcgccccctgtcgcgccggtaactataatctctgcacgaaaatgggcttc
atcgggctggctggcggaggcggcggtttgagcgaaaagatcgtcgtcgaacgtcgctgg
gttcaccccatcggagacatccccctcgatcaggccgcgctcattgaaccccttgctgtc
ggccatcacgcgttcgttcgcagtggcgcgaaagccggagatactgcttttatcggtggc
ggtggcccgatcggtctcctgctcgccgccgtgctctccgccgagggaatcaccgtcatc
atgtctgagccaggcacagcgcgccgcgaaatggcgctctctacgggggtcgccgatcac
gtgatcgatcccagtgttgaggatgccgtagccaaggtcatggaactgaccaacggagtg
ggcgccgacgtcgcattcgagtgctcgagcatcaacgcggtgctcgatcagctcttcgat
gcggtgaagcccactggagtgattgtcaacgtctccatctggggtcacccggcacagctc
gatatgcaaaaactggtgctcaaggagatcgatctgcgcggaaccattgcctacgcgcac
gatcaccctgcaaccatcaagctcgttcaagacggcaaggtcaatctggagccgttcatc
acgggtcggatccacctcgacaaactcatcgacgagggtttcatgacgttgatagatcac
aaagaaactgccgtcaaaatcatcgttcgcccggaggtcagcaatgtctcatga

DBGET integrated database retrieval system