KEGG   Streptomyces albus J1074: XNR_0759Help
Entry
XNR_0759          CDS       T02545                                 

Definition
(GenBank) Protoporphyrinogen IX oxidase, aerobic
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
salb  Streptomyces albus J1074
Pathway
salb00860  Porphyrin and chlorophyll metabolism
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:salb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    XNR_0759
Enzymes [BR:salb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     XNR_0759
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     XNR_0759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO HI0933_like FAD_binding_2 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C Pyr_redox GIDA FAD_binding_3 Lycopene_cycl NAD_binding_7 Thi4 Trp_halogenase Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGI87158
Position
complement(888997..890469)
Genome map
AA seq 490 aa AA seqDB search
MRAETEGNPAGAGGASPRVVVVGGGVAGLTAALRLLDAGAGVTLLEASERLGGKLRTGEI
GGVRVDLGAESMLARRPEAVGLAREAGLADALQPPATASASLWTRDALRPMPKGHVMGVP
ADPASLAGVLSEEGVARIAEDRALPRTEVGEDIAVGEYVAARVGREVVDRLVEPLLGGVY
AGNAYRISLRAAVPQLFAAAREHTSLTEGVRAIQARTAADPRTDPVFMGIDGGVGRLPLA
VADTVRARGGRIRTGTPVTGLARIPGGWRLTTGTPDAPESLEADAVVLAVPAPQAARLLA
AELPAASADLAEIEYASMALMTFAFRADEAELPQGSGFLVPPVDGRTVKAATFAGRKWRW
IAEQEPGLHVVRTSVGRHREEEILGRDDAGLLALARRDLKAATGVDAEPVDAHVTRWDQG
LPQYPVGHLARVARVRDQVARAPGLALCGAAYDGVGIPACVASATEAARQVMAARPQGDP
ASGPSGHAGE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcggaaacagagggaaacccggcgggagcgggtggcgcgagcccccgtgtggtg
gtcgtcggaggcggcgtcgcggggctcacggccgcgctgcgcctgctcgatgccggggcc
ggcgtcaccctcctggaagcctccgagcggctcggcggcaagctccgcaccggcgagatc
ggcggcgtccgcgtcgacctgggcgccgagtcgatgctggcccgccgccccgaggcggtc
ggcctcgcccgtgaggcgggactggccgacgccctccagccccccgccaccgccagcgcc
tccctgtggacccgcgacgccctgcgccccatgcccaagggccacgtcatgggcgtcccc
gccgacccggccagcctcgccggggtcctctcggaagagggcgtcgcgcggatcgccgag
gaccgcgccctgccccgcaccgaggtcggcgaggacatcgccgtcggcgagtacgtcgcc
gcccgggtcggccgcgaggtcgtcgaccggctcgtcgaacccctcctcggcggcgtctac
gccggcaacgcctaccgcatctcgctgcgcgccgccgtcccccagctcttcgccgccgcc
cgcgagcacacctccctgaccgagggggtccgcgcgatccaggcccgcaccgccgccgac
ccgcgcaccgaccccgtcttcatgggcatcgacggcggggtcggccgcctcccgctcgcc
gtcgccgacaccgtccgcgcccgcggcggccgcatccgcaccggtacgcccgtcaccggc
ctcgcccgcattcccggcggctggcggctgaccaccggcacccccgacgcgcccgagtcc
ctggaggccgacgccgtcgtcctcgccgtccccgcgccccaggcggcccggctgctcgct
gccgaactcccggccgcctccgccgacctcgccgagatcgagtacgcctcgatggccctg
atgaccttcgccttccgcgcggacgaggccgagctgccgcagggcagcggcttcctcgtg
ccgccggtcgacggacgcaccgtcaaggccgccaccttcgcgggacgcaagtggcggtgg
atcgccgagcaggaaccggggctgcacgtcgtccgcacctcggtcggccgccatcgcgag
gaggagatcctcggccgcgacgacgccggcctcctcgccctcgcccgccgcgacctcaag
gccgccaccggcgtcgacgccgagcccgtcgacgcccacgtgacccgctgggaccaggga
ctgccccagtacccggtcggccacctcgcccgcgtcgcccgcgtccgcgaccaggtcgcc
agggcccccggcctcgccctgtgcggcgccgcctacgacggcgtcggcatccccgcctgc
gtcgcctccgccaccgaggcggcccgccaggtcatggcggcccgcccacagggcgacccg
gcgtcgggcccgtccgggcacgcgggagaatga

DBGET integrated database retrieval system