KEGG   Streptomyces albidoflavus: XNR_0772Help
Entry
XNR_0772          CDS       T02545                                 

Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase 2
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00730  Thiamine metabolism
salb00900  Terpenoid backbone biosynthesis
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01130  Biosynthesis of antibiotics
Module
salb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    XNR_0772
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    XNR_0772
Enzymes [BR:salb01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     XNR_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C TPP_enzyme_C E1_dh PFOR_II
Motif
Other DBs
NCBI-ProteinID: AGI87171
UniProt: D6AWE8
Position
complement(905357..907282)
Genome map
AA seq 641 aa AA seqDB search
MPLLTRITGPRDLDRLSPEQLDELAAEIRAFLVDAVSKTGGHLGPNLGVVELTIALHRVF
DSPKDKVLFDTGHQSYVHKLLTGRQDFSGLRTRGGLSGYPSRAESEHDVIENSHASTVLG
WADGFAKANEVRGKDDHVVAVIGDGALTGGMAWEALNNIAAAKDRPLVIVVNDNERSYAP
TIGGLANHLATLRTTDGYERFLARGKDFLERTPVVGRPLYETLHGAKKGLKDFIAPQGMF
EDLGLKYVGPIDGHDIEALESALARAKRFGGPVIVHCLTEKGRGYQPAVQDEADRFHAVG
VIHPDTGLPVSASGADWTSVFGEEMVRLGKEREDIVAITAAMLQPVGLQKFADAFPERVY
DVGIAEQHGAVSAAGLASGGVHPVFAVYATFLNRAFDQLLMDVALHRCGVTFVLDRAGVT
GTDGASHNGMWDMSILQVVPGLRIAAPRDADQLRAQLREAVAVEDAPTVVRYSKGAVGPA
VPALGTVGGMDVLREPGTSRPDVLLVSVGALAPMCLEIAGLLDKQGISTTVVDPRWVKPV
DEALAPLAEQHRVVVTVEDNSRVGGVGSAVAQALRDAGVDVPLRDFGIPPRFLDHATRKE
VLAEIGLTAPDIARQVTGLVAKLDGRYEHGTPAQAVEPARD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgccgctgctgacccgcatcacgggaccgcgcgatctggaccgtctcagcccggagcag
cttgacgagctggccgcagagatccgggccttcctcgtcgacgccgtctccaagaccggc
ggccacctcggcccgaacctcggcgtcgtggagctgacgatcgccctgcaccgggtgttc
gactcgccgaaggacaaggtcctcttcgacaccggccaccagtcgtacgtccacaagctg
ctcaccggccgccaggacttctccggcctgcgcaccaggggcggcctctccggctacccc
tcgcgcgccgagtccgagcacgacgtcatcgagaacagccacgcctccacggtgctcggc
tgggccgacggcttcgccaaggccaacgaggtccgcggcaaggacgaccacgtcgtggcc
gtcatcggcgacggcgccctcaccggcggcatggcctgggaggcgctcaacaacatcgcc
gccgccaaggaccgcccgctggtcatcgtcgtcaacgacaacgagcgctcctacgcgccc
accatcggcggcctcgccaaccacctggcgaccctgcgcaccaccgacggctacgagcgc
ttcctcgcccgcggcaaggacttcctggagcgcaccccggtcgtcggccgcccgctctac
gagacgctgcacggcgccaagaaggggctcaaggacttcatcgccccgcagggcatgttc
gaggacctcggcctgaagtacgtcggcccgatcgacggccacgacatcgaggcactggag
tcggcgctggcccgcgccaagcggttcggcggcccggtcatcgtgcactgcctcaccgag
aagggccgcggctaccagccggccgtccaggacgaggccgaccgcttccacgcggtgggc
gtcatccaccccgacaccggcctgcccgtctccgcctccggcgccgactggacctcggtc
ttcggtgaggagatggtccggctcggcaaggagcgcgaggacatcgtggcgatcaccgcc
gccatgctccagccggtcggcctccagaagttcgccgacgccttccccgagcgggtctac
gacgtcggcatcgccgagcagcacggcgcggtctccgcggcgggcctggccagcggcggc
gtccaccccgtcttcgccgtctacgccaccttcctcaaccgcgccttcgaccagctcctg
atggacgtggccctgcaccgttgcggcgtcaccttcgtcctggaccgggccggggtcacc
ggcaccgacggcgcctcgcacaacggcatgtgggacatgtccatcctccaggtcgtcccg
ggcctgcggatcgccgccccgcgcgacgccgaccagctccgcgcccagctgcgcgaggcc
gtcgccgtcgaggacgccccgaccgtcgtccgctactccaagggcgccgtcggccccgcc
gtccccgccctcggcaccgtcggcggtatggacgtactgcgcgagccgggcacctcccgc
cccgacgtgctcctcgtctcggtcggcgcgctcgccccgatgtgcctggagatcgccggt
ctcctcgacaagcaggggatctccaccaccgtggtcgacccgcgctgggtcaagccggtc
gacgaggccctcgccccgctcgccgagcagcaccgcgtggtcgtcaccgtcgaggacaac
agccgcgtcggcggcgtcggctcggccgtcgcccaggcgctgcgcgacgccggtgtggac
gtaccgctgcgcgacttcggcatcccgccgcgcttcctcgaccacgccacccgcaaggag
gtgctggccgagatcggcctgaccgccccggacatcgcccggcaggtcaccggcctcgtc
gccaagctcgacggacggtacgagcacggcaccccggcccaggccgtcgagccggcccgc
gactga

DBGET integrated database retrieval system