KEGG   Streptomyces albidoflavus: XNR_0818Help
Entry
XNR_0818          CDS       T02545                                 

Definition
(GenBank) Ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00220  Arginine biosynthesis
salb01100  Metabolic pathways
salb01110  Biosynthesis of secondary metabolites
salb01130  Biosynthesis of antibiotics
salb01230  Biosynthesis of amino acids
Module
salb_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    XNR_0818
Enzymes [BR:salb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     XNR_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AGI87217
UniProt: D6BCE4
Position
complement(959425..960453)
Genome map
AA seq 342 aa AA seqDB search
MATDLTGRSFLRELDFTAEEFRSLVALAAELKAAKKAGTEVQRLRGRNIALIFEKTSTRT
RCAFEVAAADQGASTTYLDPSGSQMGHKESAKDTARVLGRMFDGIEYRGDSQATVEELAA
HAGVPVFNGLTDDWHPTQMLADVLTVVEHTAKPLEQVVFAYLGDARFNMGNSYLITGALL
GMDIRIVAPRAYWPAQHVVDEARRLAGRSGARITLTEEVHVGVRDADFVATDVWVSMGEP
KSVWDERIAALAPYAVTSEVLAATGNPDVVFLHCLPAFHDLGTEVGRQIHESHGLTSLEV
TDEVFESPHSAVFDQAENRLHTIKAVLVATLAGPADGAGVSG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagacctcaccggtcgcagtttcctcagagagctggacttcaccgccgaggag
ttccgctcactcgtcgcgctggccgccgagctgaaggcggccaagaaggccgggaccgag
gtccagcggctccgcgggcgcaacatcgcgctgatcttcgagaagacctccacccgcacc
cggtgcgccttcgaggtggccgccgccgaccagggcgcctccacgacctacctggacccg
tcgggctcgcagatggggcacaaggagtccgccaaggacaccgcgcgggtgctgggccgg
atgttcgacggcatcgagtaccggggggacagccaggccaccgtcgaggagctggccgcc
cacgcgggcgtgccggtcttcaacgggctgaccgacgactggcaccccacccagatgctc
gccgacgtgctgaccgtcgtcgagcacaccgcgaagccgctggagcaggtcgtcttcgcc
tacctgggcgacgcccgcttcaacatgggcaactcctacctgatcaccggcgccctgctc
ggcatggacatccggatcgtcgccccgcgcgcctactggcccgcccagcacgtcgtcgac
gaggcccgccgcctcgccggccggagcggtgcccggatcacgctgaccgaggaggtccac
gtcggggtgcgggacgcagacttcgtcgccaccgacgtctgggtctcgatgggcgagccc
aagagcgtctgggacgagcggatcgccgccctcgcgccgtacgcggtcaccagtgaggtg
ctggcggccaccggcaacccggacgtcgtcttcctgcactgcctgcccgccttccacgac
ctcggcaccgaggtcgggcggcagatccacgagagccacggcctgacctcgctggaggtc
accgacgaggtcttcgagtcgccgcactccgccgtcttcgaccaggcggagaaccggctc
cacaccatcaaggccgtcctcgtcgccaccctcgcgggcccggcggacggtgccggggtg
agtggatag

DBGET integrated database retrieval system