KEGG   Streptomyces albidoflavus: XNR_0875Help
Entry
XNR_0875          CDS       T02545                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00790  Folate biosynthesis
salb01100  Metabolic pathways
salb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    XNR_0875
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    XNR_0875
Enzymes [BR:salb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     XNR_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N
Motif
Other DBs
NCBI-ProteinID: AGI87274
Position
1027236..1028930
Genome map
AA seq 564 aa AA seqDB search
MPTASLPDSPTPRTVPAPSAAPSRSARHDAALRAAARGLDRRRLLTLGGAAAALAFATNL
PAAGAAQAAGFDARRLREDPFTLGVASGDPHPSSVLLWTRLAPRPFEPDSGLPAQRITVE
WELARDERFRRVVRRGRETAHPEFHHSVHVQVDGLDADRVYYYRFRAGAFTSPAGRTRTT
PRQGARTRELALAAVSCQAYHDGYFTAYRHLAAEDVDVVLHLGDYLYEYAVNGAGGARNY
TDRVLPAVFDRETMTLEDYRLRYGLYKSDPDLIAAHAAHPFVVTWDDHETENNYAGNQPE
NDVDPEEFLLRRASAYRAYWENQPLRLPQRPTGPDMRLYRRLHWGDLAQFDILDTRQYRS
DQAYGDGWKTPGPESEDPARTMTGGAQERWLLDGWRTSRARWNVVPQQVTFSERRNATGS
AYKLSMDSWDGYPASRERLLAGAEQAGVDHLMVLTGDVHVGYGFDIKRDFADQGSRTVGT
ELVATSIASGKDGADRPANWETYHAANPHLKFYNGRRGYLTVRLGEESARADFRTVSAVT
VPGAPLTTAGSFVTERRSPGLKPA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
gtgcccactgcttccctgcctgactcccccaccccccgtaccgttcccgcaccgtccgcc
gcgccttcccggtccgcgcgccacgatgccgccctgcgggcggccgcccggggcctggac
cggcggcggctgctgacgctgggcggggccgccgccgcgctggccttcgccaccaacctg
ccggcggcgggggcggcgcaggccgccgggttcgacgcgcgacggctgcgcgaggacccg
ttcaccctcggcgtggcctccggcgacccgcacccgtcctcggtgctgctgtggacccgg
ctcgcgccgcgccccttcgagccggacagcgggctgcccgcgcagcggatcaccgtggag
tgggagctggcccgcgacgagcggttccgccgggtcgtcagacgcggccgggagactgcc
caccccgagttccaccacagcgtccacgtgcaggtggacggcctggacgcggaccgggtc
tactactaccgcttccgcgccggagcgttcaccagccccgccggccgcacccgcaccacg
ccccgccagggcgccaggacccgcgaactggccctcgccgccgtctcctgccaggcgtac
cacgacggctacttcaccgcctaccgccacctcgcggccgaggacgtcgacgtcgtcctg
cacctcggtgactacctctacgagtacgccgtgaacggcgccggaggggcccgcaactac
accgaccgggtgctgccggccgtcttcgaccgggagaccatgacgctggaggactaccgg
ctgcggtacggcctctacaaatccgacccggacctgatcgccgcccacgccgcccacccc
ttcgtggtcacctgggacgaccacgagacggagaacaactacgcgggcaaccagccggag
aacgacgtggacccggaggagttcctgctccgccgggcctccgcctaccgcgcgtactgg
gagaaccagccgctgcggctgccgcagcgccccaccggccccgacatgcggctctaccgg
cggctgcactggggcgacctggcccagttcgacatcctcgacacccgccagtaccgctcc
gaccaggcgtacggcgacggctggaagacgccggggcccgagtccgaggaccccgcgcgc
accatgaccggcggggcgcaggagcggtggctgctcgacgggtggcgcacctcgcgggcc
cgctggaacgtggtcccgcagcaggtgaccttctccgagcggcgcaacgccaccggctcc
gcctacaagctctcgatggactcctgggacggctacccggcctcccgcgagcggctcctc
gccggggccgaacaggcgggcgtcgaccacctgatggtcctcaccggggacgtgcacgtc
ggctacggcttcgacatcaagcgggacttcgccgaccagggctcgcgcaccgtcggcacc
gaactggtcgccacctcgatcgccagcggcaaggacggcgccgaccggcccgccaactgg
gagacgtaccacgcggccaacccgcacctgaagttctacaacgggcgccgcggctacctc
accgtccgcctcggcgaggagtcggcgcgcgccgacttccgcaccgtctccgccgtcacc
gtgcccggcgccccgctcaccaccgccggatcgttcgtcaccgagcgccgctcccccggc
ctgaagcccgcctga

DBGET integrated database retrieval system