KEGG   Streptomyces albidoflavus: XNR_1580Help
Entry
XNR_1580          CDS       T02545                                 

Definition
(GenBank) Lyase
  KO
K10156  epi-isozizaene synthase [EC:4.2.3.37]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00909  Sesquiterpenoid and triterpenoid biosynthesis
salb01110  Biosynthesis of secondary metabolites
salb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    XNR_1580
Enzymes [BR:salb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.37  epi-isozizaene synthase
     XNR_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Terpene_synth_C
Motif
Other DBs
NCBI-ProteinID: AGI87968
Position
complement(1875241..1876293)
Genome map
AA seq 350 aa AA seqDB search
MPEALALPVIEQAFPRHRHEYWPKLQVESRAWLLEKRLMPADKVTRYADELRYTDLIAGY
YVGAPRDVISAISDFSTWFFVWDDQHDRDAVHGRRTAWYRLSAELHTALDAPGDHLAHPE
PLVAAFAETVHRLNGFLGPAWNERFARHFHAIVGAYDQEFENRVTKVTPKVAEYIELRRH
TFGHSVWIDLLEPTAGREIPADLRTSGPFLAAARHCQDFSAWYNDLCSLPKELAGDDQHN
LGISLIRHEGLSLEEAVVEVRKRVENCVTEFEVAEKELRELLAGHLAALPGGAGTAEARS
VAEAVGSAVFNMRNWFSSVYWFHHESGRYRVDSWDDRSTPPYVSDLAGDA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaggcgctggcgttgcccgtgatcgaacaagcgtttccgcgacatcgtcatgag
tattggccaaagcttcaggtggagtcccgcgcctggctgctcgaaaagcggctgatgccc
gccgacaaggtcacccgctatgcggacgaactccgctacaccgacctcatcgccggctac
tacgtgggcgcgccgagggacgtcatctcggcgatttccgacttcagcacctggttcttc
gtctgggacgaccagcacgaccgcgacgccgtccacgggcggcgcaccgcctggtaccgg
ctcagcgccgaactgcacaccgcgctggacgcccccggcgaccacctcgcccacccggag
ccgctggtcgcggccttcgccgagaccgtccaccggctgaacggcttcctcggccccgcc
tggaacgagcggttcgcccgccatttccacgccatcgtcggcgcctacgaccaggaattc
gagaaccgggtcaccaaggtcaccccgaaggtcgccgaatacatcgaactgcgccgccac
accttcggccactcggtctggatcgaccttctcgaacccaccgcgggacgcgagattccc
gcggacctgaggacgagtggtccctttctcgcggcagcccggcactgccaggatttctcc
gcctggtacaacgacctctgctcactcccgaaagaactcgcgggcgacgaccagcacaat
ctgggaatcagtctcatacgccatgagggactgtcgctcgaagaggccgtggtggaggtg
aggaaacgcgtggagaactgcgtcaccgaattcgaggtggcggagaaggaattgcgggaa
ctcctcgccggacatctcgccgcactccccggaggagccggcaccgccgaggcccggtcc
gtcgccgaagcggtcgggtcggccgtcttcaacatgcggaactggttctcctccgtctac
tggttccaccacgagtccggccgttaccgcgtcgacagctgggacgaccggagcaccccg
ccctacgtcagcgatctggcaggtgacgcgtga

DBGET integrated database retrieval system