KEGG   Streptomyces albidoflavus: XNR_3111Help
Entry
XNR_3111          CDS       T02545                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00450  Selenocompound metabolism
salb00970  Aminoacyl-tRNA biosynthesis
salb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XNR_3111
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XNR_3111
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:salb01007]
    XNR_3111
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:salb03016]
    XNR_3111
Enzymes [BR:salb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XNR_3111
Amino acid related enzymes [BR:salb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XNR_3111
Transfer RNA biogenesis [BR:salb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XNR_3111
 Prokaryotic type
   Other AARSs
    XNR_3111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGI89455
UniProt: D6BAQ0
Position
3535146..3536762
Genome map
AA seq 538 aa AA seqDB search
MAANGNEKQGTKAFYVTTPIYYVNDAPHLGHAYTTVAGDVLTRWHRQRGEKVWYLTGTDE
HGQKIMRTADANGVSPQEWCDKLVTEAWKPLWEHLEIANDDFIRTTEKRHTDRVQEFVQD
LWDKGEIYKGGYEGPYCVGCEEYKLPGELLDGEGDFAGEKLCPVHKKPVEILKEENYFFK
LSEYAQRLLDFYEANPGFIQPESARNEVLNFVRQGLTDLSISRSTFDWGVKVPWDDKHVI
YVWVDALLNYATAAGYGADQARFDATFPADVHLVGKDILRFHAVIWPAMLMAQGLPLPGR
VVANGWLLVGGEKMSKSNLTGIKPQDLTSHFGVDAYRWYFLRAISFGQDGSFSWEDFSAR
YTSELANDYGNLASRVAAMVNKYFGGELPAATASGEAEKAVQEGLAKAVATADRAIGEEL
DFQSGILAIFDFVKQVNGYITEQEPWKVAKDDSEEGRARLATILYTAAESLRAMAVLLNP
VMPDTSQKLWDSLGAEPHLGPLAAQRIDETADWGRLPAGATVTKGAVLFPRLEEKPTA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaatggaaacgagaagcaggggacgaaggcgttctacgtcacgaccccgatc
tactacgtcaacgacgctcctcacctgggccacgcctacacgaccgtcgcaggcgacgtg
ctcacgcgctggcaccgtcagcgcggcgagaaggtgtggtacctcaccggcacggacgag
cacggtcagaagatcatgcgcaccgccgacgccaacggggtcagcccgcaggagtggtgc
gacaagctcgtcacggaggcgtggaagcccctgtgggagcacctggagatcgccaacgac
gacttcatccgcaccaccgagaagcgccacaccgaccgcgtccaggagttcgtccaggac
ctgtgggacaagggcgagatctacaagggcggctacgagggcccgtactgcgtgggctgc
gaggagtacaagctccccggtgagctgctcgacggcgagggcgacttcgcgggcgagaag
ctctgcccggtgcacaagaagccggtggagatcctcaaggaggagaactacttcttcaag
ctgagcgagtacgcccagcgcctcctcgacttctacgaggccaacccgggcttcatccag
cccgagtccgcgcgcaacgaggtcctgaacttcgtccgccagggcctcaccgacctgtcg
atctcccgctccaccttcgactggggcgtcaaggtcccgtgggacgacaagcacgtcatc
tacgtgtgggtcgacgccctgctgaactacgccacggccgccgggtacggcgccgaccag
gcccgtttcgacgccaccttccccgccgacgtccacctcgtcggcaaggacatcctccgc
ttccacgcggtgatctggcccgccatgctgatggcgcagggcctcccgctccccggccgg
gtcgtcgccaacggctggctgctggtcggcggcgagaagatgtccaagtcgaacctgacc
ggcatcaagccgcaggacctgacctcgcacttcggcgtcgacgcgtaccgctggtacttc
ctgcgcgcgatctccttcggccaggacggctcgttctcctgggaggacttctccgcccgc
tacaccagcgagctggccaacgactacggcaacctcgcctcccgcgtcgccgccatggtg
aacaagtacttcggcggtgagctgcccgccgcgaccgcctccggcgaggccgagaaggcg
gtccaggagggcctggcgaaggccgtcgccaccgccgaccgcgcgatcggggaggagctg
gacttccagtccggcatcctcgccatcttcgacttcgtcaagcaggtcaacggctacatc
accgagcaggagccctggaaggtcgccaaggacgacagcgaggagggccgcgcccgcctc
gccaccatcctgtacacggccgccgagtcgctgcgcgccatggccgtcctgctcaacccg
gtgatgcccgacacctcccagaagctctgggactccctcggcgccgagccgcacctcggc
ccgctcgcggcccagcgcatcgacgagaccgccgactggggccgcctcccggccggcgcc
accgtcaccaagggcgccgtcctcttcccccgcctggaggagaagccgacggcctga

DBGET integrated database retrieval system