KEGG   Streptomyces albidoflavus: XNR_4976Help
Entry
XNR_4976          CDS       T02545                                 

Definition
(GenBank) Fuculose-1-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
salb  Streptomyces albidoflavus
Pathway
salb00051  Fructose and mannose metabolism
salb01100  Metabolic pathways
salb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:salb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    XNR_4976
Enzymes [BR:salb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     XNR_4976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGI91297
UniProt: A0A2A2UKH8
Position
5658034..5658756
Genome map
AA seq 240 aa AA seqDB search
MEKNRAHPGRPWRPQEDQAVAHAWHDLVETARATVRDGLVVGTSGNVSVRVTPDRPAGGT
GDLVLITPTGVPYDRLGPEDTVAVGLDGRQVLGTLKPTSELPLHLAVYRTGTARAVVHTH
APHATAVSTLVDTLPPVHYMAAALGGPVRTAPYALYGSQELAGHLVEALRDRTACLLRNH
GTVTTGDTLTQALDRTAQLEWMCRVWLLARSVPGHTPSLLDAGQLDAAAERLRGYGQPGG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaccgcgcccaccccggccgcccctggcgcccccaggaggaccaggccgtc
gcccacgcctggcacgacctcgtggagaccgcccgcgccaccgtccgcgacggactggtg
gtcggcacctccggcaacgtctcggtccgcgtcacccccgaccgcccggccggcgggacc
ggcgacctcgtcctcatcacccccaccggcgtcccctacgaccggctcggccccgaggac
accgtcgccgtcggcctcgacggccgccaggtgctcggcaccctgaagcccaccagcgag
ctccccctccacctcgccgtgtaccgcaccggcaccgcccgtgccgtcgtccacacccac
gccccgcacgccaccgccgtctccacgctcgtcgacaccctgccgccggtccactacatg
gccgccgcgctcggcggccccgtccgcaccgccccctacgccctctacggcagccaggaa
ctcgccggccacctcgtcgaggccctccgggaccgcaccgcctgcctcctgcgcaaccac
ggcaccgtcaccaccggcgacaccctcacccaggccctggaccgcaccgcccagctggag
tggatgtgccgcgtctggctgctcgcccgctccgtccccggccacaccccctccctcctc
gacgcgggacagctcgacgccgccgccgagcggctgcgcggctacggccagccgggcggg
tga

DBGET integrated database retrieval system