KEGG   Salinibacterium sp. CGMCC 1.16371: C2138_02540Help
Entry
C2138_02540       CDS       T05414                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
salc  Salinibacterium sp. CGMCC 1.16371
Pathway
salc00051  Fructose and mannose metabolism
salc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:salc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C2138_02540
Enzymes [BR:salc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     C2138_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh
Motif
Other DBs
NCBI-ProteinID: AWB88574
Position
497051..498211
Genome map
AA seq 386 aa AA seqDB search
MKAVHCGAGNIGRGFVGLLLHEAGYDVVFSDVNAELIGQLTAADSYTVHEVGEGARDHEV
TGFRAIDSSASPQSLVDEITSADLVTTAVGPTVLRFIAPAIAQGLLARSDDVAPLGVMAC
ENAINATDILRAEVERVLSEIAPGDALAALGRAVFANTAVDRIVPGQASGAGLDVTVESY
YEWAIDRTPFGGAEPSIPGATFVDDLAPYIERKLFTVNTGHATIAYYGFVAGASAISDAL
ARPEVEAAVRSVLMETKQLLVEKHGLDSAAQQAYIEKILVRFANPHLPDTVDRVGRQPLR
KLSRHERFIGPAAELAERGYTPAALIDAVATALRFDVPEDEQSVELQQKLDALSAAQFTS
EVCGIERSHPLFAPLAAAIEAQQTER
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtgcactgcggcgccggcaacatcggtcgcggctttgtgggcctgctgctg
cacgaggcgggatatgacgtcgtgttctcggatgtcaacgccgagctcattgggcagctc
accgcagccgactcctacactgtgcacgaggtgggggagggtgccagagatcacgaggtg
acgggattcagagccattgacagctccgcaagcccgcagagtctcgtcgacgagatcacg
agcgccgatctcgtgacgactgcggtcggacccacagtgctcaggtttatcgcgcccgcc
atcgcccaggggttgctcgcgcgtagcgacgatgtcgccccgttgggcgttatggcgtgc
gagaacgccatcaatgccacggacatcctgcgtgcagaggtcgagcgcgtcctgtcggag
atagccccaggagatgcgctcgcggcgctcggtcgcgcggtgtttgccaataccgctgtg
gatcgcattgtgccgggccaggcatccggagcaggcctcgatgtcaccgtcgagagctac
tacgagtgggcgatcgaccgaacgccctttggtggagcagagccgagcattccgggagcg
acttttgtcgatgacctcgctccctacattgaacgcaagctcttcacggtcaatacgggg
catgccacgatcgcctattacgggtttgtcgccggagcctcggcaatatcggatgccctc
gcgcgccccgaggtcgaggccgccgtccgatccgttcttatggagaccaagcagcttctc
gtggagaagcacgggctcgacagcgcggcccagcaggcctatatcgagaagatcctggtg
cgcttcgccaacccccatctgccggacacggtcgatcgagtagggcggcaaccgttgcgc
aaactgagccggcacgagcggttcatcggcccggccgcagagcttgcggaacgcggttac
acccccgccgcgctcatcgatgcggtggcgactgcccttcgattcgacgtgccagaagac
gagcagagcgttgagcttcaacagaaactcgatgccctcagcgccgcccagttcaccagc
gaggtgtgcggaatcgagcggtcacatccgctattcgctccgctggcggcggccatagaa
gcccagcagaccgagcgctag

DBGET integrated database retrieval system